Calnexin (CANX) (NM_001746) Human Recombinant Protein

  • Product Brand Image
SKU
TP300229
Recombinant protein of human calnexin (CANX), transcript variant 1, 20 µg
  $737.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200229 protein sequence
Red=Cloning site Green=Tags(s)

MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVY
FADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFL
FDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPK
TGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPE
DRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW
EAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS
AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILT
VALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG
GTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 65.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001737
Locus ID 821
UniProt ID P27824
Cytogenetics 5q35.3
RefSeq Size 4953
RefSeq ORF 1776
Synonyms CNX; IP90; P90
Summary This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described. provided by RefSeq, Jun 2018
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Antigen processing and presentation
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Calnexin" proteins (6)
SKU Description Size Price
PH300229 CANX MS Standard C13 and N15-labeled recombinant protein (NP_001737) 10 ug
$3,360.00
LC419769 Lyophilized CANX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422525 Lyophilized CANX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419769 Transient overexpression lysate of calnexin (CANX), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422525 Transient overexpression lysate of calnexin (CANX), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP760886 Purified recombinant protein of Human calnexin (CANX), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products