ITGB3BP (NM_014288) Human Mass Spec Standard

SKU PH300064

ITGB3BP MS Standard C13 and N15-labeled recombinant protein (NP_055103)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200064]
• Predicted MW: 20.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC200064 protein sequence; Red=Cloning site Green=Tags(s); ; MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHP; SLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK; ELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_055103
• RefSeq Size: 1019
• RefSeq ORF: 531
• Synonyms: CENP-R; CENPR; HSU37139; NRIF3; TAP20
• Locus ID: 23421
• UniProt ID: Q13352
• Cytogenetics: 1p31.3
• Summary: This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors