ITGB3BP (NM_014288) Human Mass Spec Standard
CAT#: PH300064
ITGB3BP MS Standard C13 and N15-labeled recombinant protein (NP_055103)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200064 |
Predicted MW | 20.2 kDa |
Protein Sequence |
>RC200064 protein sequence
Red=Cloning site Green=Tags(s) MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHP SLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK ELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055103 |
RefSeq Size | 1019 |
RefSeq ORF | 531 |
Synonyms | CENP-R; CENPR; HSU37139; NRIF3; TAP20 |
Locus ID | 23421 |
UniProt ID | Q13352 |
Cytogenetics | 1p31.3 |
Summary | This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402304 | ITGB3BP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402304 | Transient overexpression lysate of integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP) |
USD 436.00 |
|
TP300064 | Recombinant protein of human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review