TMX2 (NM_015959) Human Mass Spec Standard

SKU
PH300032
TMX2 MS Standard C13 and N15-labeled recombinant protein (NP_057043)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200032]
Predicted MW 34 kDa
Protein Sequence
Protein Sequence
>RC200032 protein sequence
Red=Cloning site Green=Tags(s)

MAVLAPLIALVYSVPRLSRWLAQPYYLLSALLSAAFLLVRKLPPLCHGLPTQREDGNPCDFDWREVEILM
FLSAIVMMKNRRSITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLCIVFLMTCKPPLYMGPEYIKY
FNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVST
SPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPV
ASTPTTVSDGENKKDK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057043
RefSeq Size 1741
RefSeq ORF 888
Synonyms CGI-31; NEDMCMS; PDIA12; PIG26; TXNDC14
Locus ID 51075
UniProt ID Q9Y320
Cytogenetics 11q12.1
Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines. [provided by RefSeq, Jan 2017]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TMX2 (NM_015959) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402476 TMX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428471 TMX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402476 Transient overexpression lysate of thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 100 ug
$436.00
LY428471 Transient overexpression lysate of thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 2 100 ug
$436.00
TP300032 Recombinant protein of human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721162 Purified recombinant protein of Human thioredoxin-related transmembrane protein 2 (TMX2), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.