METTL9 (NM_016025) Human Mass Spec Standard
CAT#: PH300028
METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_057109)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200028 |
Predicted MW | 32.4 kDa |
Protein Sequence |
>Peptide sequence encoded by RC200028
Blue=ORF Red=Cloning site Green=Tag(s) MTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFV SSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYAT ELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVL PFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDA VFVLKPV TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057109 |
RefSeq Size | 3267 |
RefSeq ORF | 954 |
Synonyms | CGI-81; DREV; DREV1; PAP1 |
Locus ID | 51108 |
UniProt ID | Q9H1A3 |
Cytogenetics | 16p12.2 |
Summary | Protein-histidine N-methyltransferase that specifically catalyzes 1-methylhistidine (pros-methylhistidine) methylation of target proteins (PubMed:33563959). Mediates methylation of proteins with a His-x-His (HxH) motif (where 'x' is preferably a small amino acid) (PubMed:33563959). Catalyzes methylation of target proteins such as S100A9, NDUFB3, SLC39A5, SLC39A7, ARMC6 and DNAJB12; 1-methylhistidine modification may affect the binding of zinc and other metals to its target proteins (PubMed:33563959). Constitutes the main methyltransferase for the 1-methylhistidine modification in cell (PubMed:33563959).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414244 | METTL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421369 | METTL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414244 | Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 1 |
USD 436.00 |
|
LY421369 | Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 2 |
USD 436.00 |
|
PH318283 | METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_001070648) |
USD 3,255.00 |
|
TP300028 | Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 1, 20 µg |
USD 867.00 |
|
TP318283 | Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review