METTL9 (NM_016025) Human Mass Spec Standard

SKU
PH300028
METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_057109)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200028]
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC200028
Blue=ORF Red=Cloning site Green=Tag(s)

MTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFV
SSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYAT
ELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVL
PFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDA
VFVLKPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057109
RefSeq Size 3267
RefSeq ORF 849
Synonyms CGI-81; DREV; DREV1; PAP1
Locus ID 51108
UniProt ID Q9H1A3
Cytogenetics 16p12.2
Summary Protein-histidine N-methyltransferase that specifically catalyzes 1-methylhistidine (pros-methylhistidine) methylation of target proteins (PubMed:33563959). Mediates methylation of proteins with a His-x-His (HxH) motif (where 'x' is preferably a small amino acid) (PubMed:33563959). Catalyzes methylation of target proteins such as S100A9, NDUFB3, SLC39A5, SLC39A7, ARMC6 and DNAJB12; 1-methylhistidine modification may affect the binding of zinc and other metals to its target proteins (PubMed:33563959). Constitutes the main methyltransferase for the 1-methylhistidine modification in cell (PubMed:33563959).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:METTL9 (NM_016025) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318283 METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_001070648) 10 ug
$3,255.00
LC414244 METTL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421369 METTL9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414244 Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 1 100 ug
$436.00
LY421369 Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 2 100 ug
$436.00
TP300028 Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 1, 20 µg 20 ug
$737.00
TP318283 Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.