Ngf (NM_001277055) Rat Tagged ORF Clone

SKU
RR216118
Ngf (myc-DDK-tagged) - Rat nerve growth factor (beta polypeptide) (Ngf)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Rat Tagged ORF Clone
Target Symbol Ngf
Synonyms beta-NGF; Ngfb
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RR216118 representing NM_001277055
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCATGTTGTTCTACACTCTGATCACAGCGTTTTTGATCGGCGTACAGGCAGAACCGTACACAGATA
GCAATGTCCCAGAGGGAGACTCTGTCCCTGAAGCCCACTGGACTAAACTTCAGCATTCCCTTGACACAGC
CCTCCGCAGAGCCCGCAGTGCCCCTGCTGAACCAATAGCTGCCCGTGTGACAGGGCAGACCCGCAACATC
ACTGTGGACCCCAAACTGTTTAAGAAACGGAGACTCCGTTCACCCCGCGTGCTGTTTAGCACCCAGCCTC
CACCCACCTCTTCGGACACTCTGGATTTAGACTTCCAGGCCCATGGTACAATCTCCTTCAACAGGACTCA
CAGGAGCAAGCGCTCATCCACCCACCCAGTCTTCCACATGGGGGAGTTTTCAGTGTGTGACAGTGTCAGT
GTGTGGGTTGGAGATAAGACCACAGCCACGGACATCAAGGGCAAGGAGGTGACAGTGCTGGGCGAGGTGA
ACATTAACAACAGTGTATTCAAACAGTATTTTTTTGAGACCAAGTGCCGAGCCCCGAATCCTGTAGAGAG
TGGATGCCGGGGCATTGACTCCAAGCACTGGAACTCATACTGCACCACGACTCACACCTTTGTCAAGGCG
TTGACAACAGACGACAAACAGGCTGCCTGGAGGTTCATCAGGATAGATACAGCCTGCGTGTGTGTGCTCA
GCAGGAAGGCTGCAAGAAGAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR216118 representing NM_001277055
Red=Cloning site Green=Tags(s)

MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPAEPIAARVTGQTRNI
TVDPKLFKKRRLRSPRVLFSTQPPPTSSDTLDLDFQAHGTISFNRTHRSKRSSTHPVFHMGEFSVCDSVS
VWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKA
LTTDDKQAAWRFIRIDTACVCVLSRKAARRG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001277055
ORF Size 723 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001277055.1, NP_001263984.1
RefSeq Size 1075 bp
RefSeq ORF 726 bp
Locus ID 310738
UniProt ID P25427
Cytogenetics 2q34
MW 27 kDa
Summary Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival (By similarity). The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro) (By similarity). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI (By similarity). Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Ngf (NM_001277055) Rat Tagged ORF Clone
Your Rating
SKU Description Size Price
RN216118 Ngf (untagged) - Rat nerve growth factor (beta polypeptide) (Ngf) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.