Rps5 (NM_001105722) Rat Tagged ORF Clone

SKU
RR211636
Rps5 (Myc-DDK-tagged ORF) - Rat ribosomal protein S5 (Rps5), (10 ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Rat Tagged ORF Clone
Target Symbol Rps5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RR211636 representing NM_001105722
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGAATGGGAAACAGCCACACCCGCGGTGGCAGAGACCCCGGACATCAAGCTCTTTGGGAAATGGA
GCACTGATGATGTGCAGATCAACGATATTTCTCTACAGGATTACATTGCTGTGAAGGAGAAGTATGCCAA
GTACCTGCCCCACAGTGCAGGACGGTATGCTGCCAAGCGTTTCCGCAAAGCACAGTGTCCCATCGTGGAG
CGCCTTACTAACTCCATGATGATGCACGGTCGTAACAACGGCAAGAAGCTCATGACTGTACGAATTGTCA
AGCATGCCTTTGAGATCATCCACCTGCTCACTGGTGAGTGGCCCCCGAGAAGACTCAACACGCATTGGGC
GGGCTGGAACAGTGAGACGGCAGGCTGTGGATGTATCCCCACTTCGCCGAGTGAATCAGGCCATCTGGCT
GCTGTGCACGGGGGCTCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR211636 representing NM_001105722
Red=Cloning site Green=Tags(s)

MTEWETATPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPIVE
RLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGEWPPRRLNTHWAGWNSETAGCGCIPTSPSESGHLA
AVHGGS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001105722
ORF Size 438 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001105722.1, NP_001099192.1
RefSeq Size 726 bp
RefSeq ORF 441 bp
Locus ID 25538
Cytogenetics 1q12
MW 16.3 kDa
Summary mouse homolog is a component of the 40S subunit [RGD, Feb 2006]
Write Your Own Review
You're reviewing:Rps5 (NM_001105722) Rat Tagged ORF Clone
Your Rating
SKU Description Size Price
RN211636 Rps5 (untagged ORF) - Rat ribosomal protein S5 (Rps5), (10 ug) 10 ug
$165.00
RR211636L3 Lenti ORF clone of Rps5 (Myc-DDK-tagged ORF) - Rat ribosomal protein S5 (Rps5), (10 ug) 10 ug
$465.00
RR211636L4 Lenti ORF clone of Rps5 (mGFP-tagged ORF) - Rat ribosomal protein S5 (Rps5), (10 ug) 10 ug
$465.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.