Ltc4s (NM_053639) Rat Tagged ORF Clone

SKU
RR211274
Ltc4s (Myc-DDK-tagged ORF) - Rat leukotriene C4 synthase (Ltc4s), (10 ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Rat Tagged ORF Clone
Target Symbol Ltc4s
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RR211274 representing NM_053639
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGAAGAAACAGCTCTTCTGGCTACCGTCACCCTCGTGGGAGTTCTGCTGCAAGCCTACTTCTCCC
TACAGGTGATCTCTGCGCGAAGAACTTTCCACGTGTCGCCGCCGCTCACCTCTGGCCCTCCCGAGTTCGA
GCGCGTCTTCCGAGCCCAGGTAAATTGCAGCGAGTACTTTCCGCTGTTCCTCGCCACGCTCTGGGTCGCC
GGCATCTTCTTCCACGAAGGCGCCGCAGCCCTGTGCGGGCTGTTCTACCTGTTCGCGCGGCTCCGCTACT
TCCAGGGATACGCGCGCTCCGCACAGCACAGGCTGGATCCCCTGTACGCGAGCGCGCGCGCGCTCTGGCT
GCTAGTGGCAATGGCTGCACTGGGCTTGCTAGTCCACTTCCTCCCTGGCACACTACGGGCTGCGCTCTTC
AGATGGCTCCAGGTGCTCCTGCCGATGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR211274 representing NM_053639
Red=Cloning site Green=Tags(s)

MKEETALLATVTLVGVLLQAYFSLQVISARRTFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVA
GIFFHEGAAALCGLFYLFARLRYFQGYARSAQHRLDPLYASARALWLLVAMAALGLLVHFLPGTLRAALF
RWLQVLLPMA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_053639
ORF Size 450 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_053639.2, NP_446091.2
RefSeq Size 506 bp
RefSeq ORF 453 bp
Locus ID 114097
UniProt ID Q925U2
Cytogenetics 10q22
MW 16.8 kDa
Summary conjugates leukotriene LTA4 with reduced glutathione (GSH) to form LTC4, mediates inflammatory responses in mast cells, eosinophils, basophils, monocytes-macrophages, and platelets [RGD, Feb 2006]
Write Your Own Review
You're reviewing:Ltc4s (NM_053639) Rat Tagged ORF Clone
Your Rating
SKU Description Size Price
RN211274 Ltc4s (untagged ORF) - Rat leukotriene C4 synthase (Ltc4s), (10 ug) 10 ug
$165.00
RR211274L3 Lenti ORF clone of Ltc4s (Myc-DDK-tagged ORF) - Rat leukotriene C4 synthase (Ltc4s), (10 ug) 10 ug
$465.00
RR211274L4 Lenti ORF clone of Ltc4s (mGFP-tagged ORF) - Rat leukotriene C4 synthase (Ltc4s), (10 ug) 10 ug
$465.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.