Tmem100 (NM_001017479) Rat Tagged ORF Clone

SKU
RR210875
Tmem100 (Myc-DDK-tagged ORF) - Rat transmembrane protein 100 (Tmem100), (10 ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Rat Tagged ORF Clone
Target Symbol Tmem100
Synonyms MGC108778
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RR210875 representing NM_001017479
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGAAGAACCCACAAAAGAGAACCTGGGAGGCCCGAAGTCTCCCACACCTGTGACAATGGAGAAAA
GCCCCAAGAGTGAAGTTGTGGTCACCACGGTCCCCTTGGTCAGTGAGGTTCAGCTGACGGCCGCCACCGG
GGGTGCCGAACTCTCTTGCTACCGCTGCATCATCCCCTTTGCCGTGGTGGTCTTCATCACCGGGATCGTG
GTCACCGCTGTAGCTTACAGCTTCAATTCCCATGGTTCCGTCATCTCCATCTTAGGCCTGGTCCTTCTGT
CCTCTGGACTGTTTTTACTAGCCTCCAGCGCGTTGTGCTGGAAGGTGAGACAAAGGAACAAAAAAGTCAA
GAGACGCGAGAGTCAGACGGCTCTGGTGGTAAATCAGAGAAGTTTGTTTGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR210875 representing NM_001017479
Red=Cloning site Green=Tags(s)

MTEEPTKENLGGPKSPTPVTMEKSPKSEVVVTTVPLVSEVQLTAATGGAELSCYRCIIPFAVVVFITGIV
VTAVAYSFNSHGSVISILGLVLLSSGLFLLASSALCWKVRQRNKKVKRRESQTALVVNQRSLFA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001017479
ORF Size 402 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001017479.1, NP_001017479.1
RefSeq Size 1424 bp
RefSeq ORF 405 bp
Locus ID 497979
UniProt ID Q569C0
Cytogenetics 10q26
MW 14.4 kDa
Summary Plays a role during embryonic arterial endothelium differentiation and vascular morphogenesis through the ACVRL1 receptor-dependent signaling pathway upon stimulation by bone morphogenetic proteins, such as GDF2/BMP9 and BMP10. Involved in the regulation of nociception, acting as a modulator of the interaction between TRPA1 and TRPV1, two molecular sensors and mediators of pain signals in dorsal root ganglia (DRG) neurons. Mechanistically, it weakens their interaction, thereby releasing the inhibition of TRPA1 by TRPV1 and increasing the single-channel open probability of the TRPA1-TRPV1 complex.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Tmem100 (NM_001017479) Rat Tagged ORF Clone
Your Rating
SKU Description Size Price
RN210875 Tmem100 (untagged ORF) - Rat transmembrane protein 100 (Tmem100), (10 ug) 10 ug
$165.00
RR210875L3 Lenti ORF clone of Tmem100 (Myc-DDK-tagged ORF) - Rat transmembrane protein 100 (Tmem100), (10 ug) 10 ug
$465.00
RR210875L4 Lenti ORF clone of Tmem100 (mGFP-tagged ORF) - Rat transmembrane protein 100 (Tmem100), (10 ug) 10 ug
$465.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.