Alg13 (NM_001013951) Rat Tagged ORF Clone

SKU
RR210207
Alg13 (Myc-DDK-tagged ORF) - Rat asparagine-linked glycosylation 13 homolog (S. cerevisiae) (Alg13), (10 ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Rat Tagged ORF Clone
Target Symbol Alg13
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RR210207 representing NM_001013951
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGAGAGCGTTTGTGACCGTCGGGACCACCAGTTTCGACGACCTCGTCGCTCGTGTGGTCGCCAACG
ATACGGTTCAGATACTCAAGAGTCTGGGTTACAACCACCTTGTCCTACAAATTGGTAGAGGCACTGTGGT
GCCTGAGCCATTCAGTACTGAGCCATTCACTCTGGATGTTTACAGGTATAAGGAGTCTTTGAAAGAAGAC
CTTCAGCAAGCTGATCTTGTCATTAGCCACGCAGGTGCAGGAAGCTGTTTGGAGAGTCTAGAAAAAGGCA
AGCCACTTGTGGTAGTTGTAAATGAAAAGTTAATGAACAATCATCAATTTGAACTGGCAAAGCAGTTACA
CAAAGAAGGCCATCTCTTCTATTGTACTTGCAGCATGCTTCCTGGGCTGTTACAGTCAATGGATTTATCA
ACACTGAAATGTTATCCTCCTGGCCAGCCAGAAAAATTTTCTGCATTTTTGGATAAAGTTGTTGGATTAC
AAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR210207 representing NM_001013951
Red=Cloning site Green=Tags(s)

MKRAFVTVGTTSFDDLVARVVANDTVQILKSLGYNHLVLQIGRGTVVPEPFSTEPFTLDVYRYKESLKED
LQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEGHLFYCTCSMLPGLLQSMDLS
TLKCYPPGQPEKFSAFLDKVVGLQK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001013951
ORF Size 495 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001013951.1, NP_001013973.1
RefSeq Size 1625 bp
RefSeq ORF 498 bp
Locus ID 300284
UniProt ID Q5I0K7
Cytogenetics Xq34
MW 18.3 kDa
Summary May be involved in protein N-glycosylation, second step of the dolichol-linked oligosaccharide pathway.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Alg13 (NM_001013951) Rat Tagged ORF Clone
Your Rating
SKU Description Size Price
RN210207 Alg13 (untagged ORF) - Rat asparagine-linked glycosylation 13 homolog (S. cerevisiae) (Alg13), (10 ug) 10 ug
$165.00
RR210207L3 Lenti ORF clone of Alg13 (Myc-DDK-tagged ORF) - Rat asparagine-linked glycosylation 13 homolog (S. cerevisiae) (Alg13), (10 ug) 10 ug
$465.00
RR210207L4 Lenti ORF clone of Alg13 (mGFP-tagged ORF) - Rat asparagine-linked glycosylation 13 homolog (S. cerevisiae) (Alg13), (10 ug) 10 ug
$465.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.