Lim2 (NM_053771) Rat Tagged ORF Clone

SKU
RR208451
Lim2 (Myc-DDK-tagged ORF) - Rat lens intrinsic membrane protein 2 (Lim2), (10 ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Rat Tagged ORF Clone
Target Symbol Lim2
Synonyms Mp19; MP20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RR208451 representing NM_053771
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACAGCTTCATGGGTGGCGGCCTCTTCTGTGCCTGGGTGGGGACCATCCTGTTGGTGGTAGCCACAG
CGACGGACCATTGGATGCAATACCGGCTGTCAGGGTCCTTTGCACACCAGGGCCTGTGGCGTTACTGCCT
GGGCAACAAGTGCTTCCTGCAGACAGAGAGCATCGCATACTGGAATGCCACGCGGGCTTTCATGATCCTG
TCTGCCCTGTGTGCCACCTCGGGCATCATCATGGGTGTCCTGGCCTTTGCGCAGCAATCCACCTTCACCC
GCCTCTCCAGGCCCTTCTCTGCTGGCATCATGTTTTTTGCCTCCACCCTTTTCGTCCTGTTGGCCTTGGC
CATTTACACCGGAGTCACCGTTAGTTTCCTCGGCCGCCGCTTTGGGGACTGGCGCTTTTCATGGTCTTAC
ATCCTGGGCTGGGTGGCCCTGCTCATGACCTTCTTTGCAGGAATTTTCTACATGTGTGCCTACCGGATGC
ATGAGTGCCGGCGCCTATCCACCCCACGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR208451 representing NM_053771
Red=Cloning site Green=Tags(s)

MYSFMGGGLFCAWVGTILLVVATATDHWMQYRLSGSFAHQGLWRYCLGNKCFLQTESIAYWNATRAFMIL
SALCATSGIIMGVLAFAQQSTFTRLSRPFSAGIMFFASTLFVLLALAIYTGVTVSFLGRRFGDWRFSWSY
ILGWVALLMTFFAGIFYMCAYRMHECRRLSTPR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_053771
ORF Size 519 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_053771.1, NP_446223.1
RefSeq Size 841 bp
RefSeq ORF 522 bp
Locus ID 114903
UniProt ID P54825
Cytogenetics 1q22
MW 19.6 kDa
Summary lens fiber-cell intrinsic membrane protein; ligand of galectin-3 [RGD, Feb 2006]
Write Your Own Review
You're reviewing:Lim2 (NM_053771) Rat Tagged ORF Clone
Your Rating
SKU Description Size Price
RN208451 Lim2 (untagged ORF) - Rat lens intrinsic membrane protein 2 (Lim2), (10 ug) 10 ug
$330.00
RR208451L3 Lenti ORF clone of Lim2 (Myc-DDK-tagged ORF) - Rat lens intrinsic membrane protein 2 (Lim2), (10 ug) 10 ug
$630.00
RR208451L4 Lenti ORF clone of Lim2 (mGFP-tagged ORF) - Rat lens intrinsic membrane protein 2 (Lim2), (10 ug) 10 ug
$630.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.