Cylicin 1 (CYLC1) (NM_001271680) Human Tagged ORF Clone

SKU
RG235450
CYLC1 (tGFP-tagged) - Human cylicin, basic protein of sperm head cytoskeleton 1 (CYLC1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$365.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cylicin 1
Synonyms CYCL1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG235450 representing NM_001271680.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGTCTCTTCCAAGGCTAAAAGTAAACATCAGAACATATGATAATTCCATTCCAATCAGTGAATCAAGC
AGAAAATCATGGAATCAAAAACACTTTGCTTTGACATTTCCCAAACCACTCCAGAGAGGTACAAATGAT
AAATCAAGACCTTTGAAATCACAAATAACAGTTACTCCTGAAGCACCGTGGATTCATAAGCTGCTT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
Protein Sequence
>Peptide sequence encoded by RG235450
Blue=ORF Red=Cloning site Green=Tag(s)

MSLPRLKVNIRTYDNSIPISESSRKSWNQKHFALTFPKPLQRGTNDKSRPLKSQITVTPEAPWIHKLL
TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV

Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001271680
ORF Size 207 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001271680.1, NP_001258609.1
RefSeq Size 394 bp
RefSeq ORF 207 bp
Locus ID 1538
Cytogenetics Xq21.1
MW 8.3 kDa
Summary This gene encodes a sperm head cytoskeletal protein. The encoded protein is associated with the calyx of spermatozoa and spermatids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
Write Your Own Review
You're reviewing:Cylicin 1 (CYLC1) (NM_001271680) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC235450 CYLC1 (myc-DDK-tagged) - Human cylicin, basic protein of sperm head cytoskeleton 1 (CYLC1), transcript variant 2 10 ug
$165.00
SC333344 CYLC1 (untagged) - Human cylicin, basic protein of sperm head cytoskeleton 1 (CYLC1), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.