Claudin 7 (CLDN7) (NM_001185023) Human Tagged ORF Clone

SKU
RG229582
CLDN7 (tGFP-tagged) - Human claudin 7 (CLDN7), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Claudin 7
Synonyms CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG229582 representing NM_001185023
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAATTCGGGCCTGCAGTTGCTGGGCTTCTCCATGGCCCTGCTGGGCTGGGTGGGTCTGGTGGCCT
GCACCGCCATCCCGCAGTGGCAGATGAGCTCCTATGCGGGTGACAACATCATCACGGCCCAGGCCATGTA
CAAGGGGCTGTGGATGGACTGCGTCACGCAGAGCACGGGGATGATGAGCTGCAAAATGTACGACTCGGTG
CTCGCCCTGTCCGCGGCCTTGCAGGCCACTCGAGCCCTAATGGTGGTCTCCCTGGTGCTGGGCTTCCTGG
CCATGTTTGTGGCCACGATGGGCATGAAGTGCACGCGCTGTGGGGGAGACGACAAAGTGAAGAAGGCCCG
TATAGCCATGGGTGGAGGCATAATTTTCATCGTGGCAGGTATGAGTTTGGCCCTGCCATCTTTATTGGCT
GGGCAGGGTCTGCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG229582 representing NM_001185023
Red=Cloning site Green=Tags(s)

MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSV
LALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGMSLALPSLLA
GQGLP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001185023
ORF Size 435 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001185023.1, NP_001171952.1
RefSeq Size 1944 bp
RefSeq ORF 438 bp
Locus ID 1366
UniProt ID O95471
Cytogenetics 17p13.1
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
Summary This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:Claudin 7 (CLDN7) (NM_001185023) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC229582 CLDN7 (Myc-DDK-tagged)-Human claudin 7 (CLDN7), transcript variant 3 10 ug
$150.00
RC229582L3 Lenti ORF clone of Human claudin 7 (CLDN7), transcript variant 3, Myc-DDK-tagged 10 ug
$450.00
RC229582L4 Lenti ORF clone of Human claudin 7 (CLDN7), transcript variant 3, mGFP tagged 10 ug
$450.00
SC328220 CLDN7 (untagged)-Human claudin 7 (CLDN7) transcript variant 3 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.