SCOC (NM_001153446) Human Tagged ORF Clone

SKU
RG228730
SCOC (tGFP-tagged) - Human short coiled-coil protein (SCOC), transcript variant 6
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$670.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SCOC
Synonyms HRIHFB2072; SCOCO; UNC-69
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG228730 representing NM_001153446
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGGGTCCAGGAAAGAGGAGGAGGAAGACAGCACATTCACCAACATTTCTCTTGCAGATGACATAG
ACCATTCCTCAAGAATTTTGTATCCAAGGCCCAAAAGTTTGTTACCCAAGATGATGAATGCTGACATGGA
TGTTGATGCTGAAAATCAAGTGGAACTGGAGGAAAAAACAAGACTTATTAATCAAGTGTTGGAACTCCAA
CACACACTTGAAGATCTCTCTGCAAGAGTAGATGCAGTTAAGGAAGAAAATCTGAAGCTAAAATCAGAAA
ACCAAGTTCTTGGACAATATATAGAAAATCTCATGTCAGCTTCTAGTGTTTTTCAAACAACTGACACAAA
AAGCAAAAGAAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG228730 representing NM_001153446
Red=Cloning site Green=Tags(s)

MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQ
HTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001153446
ORF Size 363 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001153446.1, NP_001146918.1
RefSeq Size 1876 bp
RefSeq ORF 369 bp
Locus ID 60592
UniProt ID Q9UIL1
Cytogenetics 4q31.1
Summary This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Write Your Own Review
You're reviewing:SCOC (NM_001153446) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC228730 SCOC (Myc-DDK-tagged)-Human short coiled-coil protein (SCOC), transcript variant 6 10 ug
$470.00
RC228730L3 Lenti ORF clone of Human short coiled-coil protein (SCOC), transcript variant 6, Myc-DDK-tagged 10 ug
$770.00
RC228730L4 Lenti ORF clone of Human short coiled-coil protein (SCOC), transcript variant 6, mGFP tagged 10 ug
$770.00
SC327365 SCOC (untagged)-Human short coiled-coil protein (SCOC) transcript variant 6 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.