ING4 (NM_001127586) Human Tagged ORF Clone

SKU
RG225191
ING4 (tGFP-tagged) - Human inhibitor of growth family, member 4 (ING4), transcript variant 6
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ING4
Synonyms my036; p29ING4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG225191 representing NM_001127586
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCGGGGATGTATTTGGAACATTATCTGGACAGTATTGAAAACCTTCCCTTTGAATTACAGAGAA
ACTTTCAGCTCATGAGGGACCTAGACCAAAGAACAGAGGACCTGAAGGCTGAAATTGACAAGTTGGCCAC
TGAGTATATGAGTAGTGCCCGCAGCCTGAGCTCCGAGGAAAAATTGGCCCTTCTCAAACAGATCCAGGAA
GCCTATGGCAAGTGCAAGGAATTTGGTGACGACAAGGTGCAGCTTGCCATGCAGACCTATGAGATGGTGG
ACAAACACATTCGGCGGCTGGACACAGACCTGGCCCGTTTTGAGGCTGATCTCAAGGAGAAACAGATTGA
GTCAAGTGACTATGACAGCTCTTCCAGCAAAGGCAAAAAGAAAGGCCGGACTCAAAAGGAGAAGAAAGCT
GCTCGTGCTCGTTCCAAAGGGAAAAACTCGGATGAAGAAGCCCCCAAGACTGCCCAGAAGAAGTTAAAGC
TCGTGCGCACTGTTCCATTGAGTGGTTCCATTTTGCCTGTGTGGGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG225191 representing NM_001127586
Red=Cloning site Green=Tags(s)

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE
AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA
ARARSKGKNSDEEAPKTAQKKLKLVRTVPLSGSILPVWG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001127586
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001127586.2
RefSeq Size 1313 bp
RefSeq ORF 540 bp
Locus ID 51147
UniProt ID Q9UNL4
Cytogenetics 12p13.31
Protein Families Druggable Genome, Transcription Factors
Summary This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in the TP53-dependent regulatory pathway. Multiple alternatively spliced transcript variants have been observed that encode distinct proteins. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ING4 (NM_001127586) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225191 ING4 (Myc-DDK-tagged)-Human inhibitor of growth family, member 4 (ING4), transcript variant 6 10 ug
$300.00
RC225191L3 Lenti ORF clone of Human inhibitor of growth family, member 4 (ING4), transcript variant 6, Myc-DDK-tagged 10 ug
$600.00
RC225191L4 Lenti ORF clone of Human inhibitor of growth family, member 4 (ING4), transcript variant 6, mGFP tagged 10 ug
$600.00
SC322872 ING4 (untagged)-Human inhibitor of growth family, member 4 (ING4), transcript variant 6 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.