TAL2 (NM_005421) Human Tagged ORF Clone

SKU
RG224692
TAL2 (tGFP-tagged) - Human T-cell acute lymphocytic leukemia 2 (TAL2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TAL2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG224692 representing NM_005421
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCAGGAAGATCTTCACAAATACCAGGGAGCGGTGGAGGCAGCAGAATGTCAACAGCGCCTTTGCCA
AGCTGAGGAAGCTCATCCCCACTCACCCTCCAGACAAAAAGCTGAGCAAAAATGAAACGCTTCGCCTGGC
AATGAGGTATATCAACTTCTTGGTCAAGGTCTTGGGGGAGCAAAGCCTGCAACAAACGGGAGTGGCTGCT
CAGGGGAACATTCTGGGGCTCTTCCCTCAAGGACCCCACCTGCCAGGCCTGGAGGACAGAACTCTGCTTG
AGAACTACCAGGTTCCTTCACCTGGTCCAAGCCACCACATTCCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG224692 representing NM_005421
Red=Cloning site Green=Tags(s)

MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAA
QGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005421
ORF Size 324 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005421.3
RefSeq Size 327 bp
RefSeq ORF 327 bp
Locus ID 6887
UniProt ID Q16559
Cytogenetics 9q31.2
Protein Families Druggable Genome
Summary This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. [provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:TAL2 (NM_005421) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224692 TAL2 (Myc-DDK-tagged)-Human T-cell acute lymphocytic leukemia 2 (TAL2) 10 ug
$150.00
RC224692L3 Lenti ORF clone of Human T-cell acute lymphocytic leukemia 2 (TAL2), Myc-DDK-tagged 10 ug
$450.00
RC224692L4 Lenti ORF clone of Human T-cell acute lymphocytic leukemia 2 (TAL2), mGFP tagged 10 ug
$450.00
SC303640 TAL2 (untagged)-Human T-cell acute lymphocytic leukemia 2 (TAL2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.