DCTD (NM_001012732) Human Tagged ORF Clone

SKU
RG223090
DCTD (tGFP-tagged) - Human dCMP deaminase (DCTD), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DCTD
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG223090 representing NM_001012732
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGGCGGGGGCCAGCCGTGCGGACCCAACATGAGTGAAGTTTCCTGCAAGAAACGGGACGACTATT
TGGAATGGCCAGAGTATTTTATGGCTGTGGCCTTCTTATCAGCACAGAGAAGCAAAGATCCAAATTCCCA
GGTCGGCGCCTGCATCGTGAATTCAGAAAACAAGATTGTCGGGATTGGGTACAATGGGATGCCAAATGGG
TGCAGTGATGACGTGTTGCCTTGGAGAAGGACAGCAGAGAATAAGCTGGACACCAAATACCCGTACGTGT
GCCATGCGGAGCTGAATGCCATCATGAACAAAAATTCGACCGATGTGAAAGGCTGTAGTATGTATGTTGC
CTTGTTCCCTTGTAATGAATGCGCTAAGCTCATCATCCAGGCAGGTATAAAAGAAGTGATTTTCATGTCT
GATAAATACCATGATAGTGACGAGGCAACTGCTGCGAGGCTCCTGTTTAATATGGCCGGGGTGACATTCC
GGAAATTCATACCGAAGTGCAGCAAGATTGTCATTGACTTTGATTCAATTAACAGCAGACCGAGTCAAAA
GCTTCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG223090 representing NM_001012732
Red=Cloning site Green=Tags(s)

MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNG
CSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMS
DKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001012732
ORF Size 567 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001012732.1, NP_001012750.1
RefSeq Size 2042 bp
RefSeq ORF 570 bp
Locus ID 1635
UniProt ID P32321
Cytogenetics 4q35.1
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Summary The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DCTD (NM_001012732) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223090 DCTD (Myc-DDK-tagged)-Human dCMP deaminase (DCTD), transcript variant 1 10 ug
$450.00
RC223090L3 Lenti ORF clone of Human dCMP deaminase (DCTD), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC223090L4 Lenti ORF clone of Human dCMP deaminase (DCTD), transcript variant 1, mGFP tagged 10 ug
$750.00
SC301714 DCTD (untagged)-Human dCMP deaminase (DCTD), transcript variant 1 10 ug
$480.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.