IGFL2 (NM_001002915) Human Tagged ORF Clone

SKU
RG222557
IGFL2 (tGFP-tagged) - Human IGF-like family member 2 (IGFL2), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IGFL2
Synonyms UNQ645; VPRI645
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG222557 representing NM_001002915
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGACCGACTACCCCAGGAGTGTGCTGGCTCCTGCTTATGTGTCAGTCTGTCTCCTCCTCTTGTGTC
CAAGGGAAGTCATCGCTCCCGCTGGCTCAGAACCATGGCTGTGCCAGCCGGCACCCAGGTGTGGAGACAA
GATCTACAACCCCTTGGAGCAGTGCTGTTACAATGACGCCATCGTGTCCCTGAGCGAGACCCGCCAATGT
GGTCCCCCCTGCACCTTCTGGCCCTGCTTTGAGCTCTGCTGTCTTGATTCCTTTGGCCTCACAAACGATT
TTGTTGTGAAGCTGAAGGTTCAGGGTGTGAATTCCCAGTGCCACTCATCTCCCATCTCCAGTAAATGTGA
AAGCAGAAGACGTTTTCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG222557 representing NM_001002915
Red=Cloning site Green=Tags(s)

MRTDYPRSVLAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQC
GPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001002915
ORF Size 369 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001002915.1, NP_001002915.1
RefSeq Size 894 bp
RefSeq ORF 393 bp
Locus ID 147920
UniProt ID Q6UWQ7
Cytogenetics 19q13.32
Protein Families Secreted Protein
Summary IGFL2 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006 [PubMed 16890402]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:IGFL2 (NM_001002915) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222557 IGFL2 (Myc-DDK-tagged)-Human IGF-like family member 2 (IGFL2), transcript variant 1 10 ug
$289.00
RC222557L3 Lenti-ORF clone of IGFL2 (Myc-DDK-tagged)-Human IGF-like family member 2 (IGFL2), transcript variant 1 10 ug
$450.00
RC222557L4 Lenti-ORF clone of IGFL2 (mGFP-tagged)-Human IGF-like family member 2 (IGFL2), transcript variant 1 10 ug
$450.00
SC300483 IGFL2 (untagged)-Human IGF-like family member 2 (IGFL2), transcript variant 1 10 ug
$165.00
SC327731 IGFL2 (untagged)-Human IGF-like family member 2 (IGFL2) transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.