CLEC2D (NM_001004419) Human Tagged ORF Clone

SKU
RG221680
CLEC2D (tGFP-tagged) - Human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CLEC2D
Synonyms CLAX; LLT1; OCIL
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG221680 representing NM_001004419
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATGACAGTAACAATGTGGAGAAAGACATTACACCATCTGAATTGCCTGCAAACCCAGGTTGTCTGC
ATTCAAAAGAGCATTCTATTAAAGCTACCTTAATTTGGCGCTTATTTTTCTTAATCATGTTTCTGACAAT
CATAGTGTGTGGAATGGTTGCTGCTTTAAGCGCAATAAGAGCTAACTGCCATCAAGAGCCATCAGTATGT
CTTCAAGCTGCATGCCCAGAAAGCTGGATTGGTTTTCAAAGAAAGTGTTTCTATTTTTCTGATGACACCA
AGAACTGGACATCAAGTCAGAGGTTTTGTGACTCACAAGATGCTGATCTTGCTCAGGTTGAAAGCTTCCA
GGAACTGAATTTCCTGTTGAGATATAAAGGCCCATCTGATCACTGGATTGGGCTGAGCAGAGAACAAGGC
CAACCATGGAAATGGATAAATGGTACTGAATGGACAAGACAGTTAGTCATGAAAGAAGATGGTGCCAACT
TGTATGTTGCAAAGGTTTCACAAGTTCCTCGAATGAATCCAAGACCTGTCATGGTTTCCTATCCTGGGAG
CAGGAGAGTGTGCCTATTTGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG221680 representing NM_001004419
Red=Cloning site Green=Tags(s)

MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC
LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG
QPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001004419
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001004419.5
RefSeq Size 1821 bp
RefSeq ORF 585 bp
Locus ID 29121
UniProt ID Q9UHP7
Cytogenetics 12p13.31
Protein Families Druggable Genome, Transmembrane
Summary This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010]
Write Your Own Review
You're reviewing:CLEC2D (NM_001004419) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221680 CLEC2D (Myc-DDK-tagged)-Human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2 10 ug
$300.00
RC221680L1 Lenti ORF clone of Human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC221680L2 Lenti ORF clone of Human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2, mGFP tagged 10 ug
$600.00
RC221680L3 Lenti ORF clone of Human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC221680L4 Lenti ORF clone of Human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2, mGFP tagged 10 ug
$600.00
SC300674 CLEC2D (untagged)-Human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.