BEX1 (NM_018476) Human Tagged ORF Clone

SKU
RG220965
BEX1 (tGFP-tagged) - Human brain expressed, X-linked 1 (BEX1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BEX1
Synonyms BEX2; HBEX2; HGR74-h
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG220965 representing NM_018476
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTCCAAAGAGAAACGAGCAGTAAACAGTCTCAGCATGGAAAATGCCAACCAAGAAAATGAAGAAA
AGGAGCAAGTTGCTAATAAAGGGGAGCCCTTGGCCCTCCCTTTGGATGCTGGTGAATACTGTGTGCCTAG
AGGAAATCGTAGGCGGTTCCGCGTTAGGCAGCCCATCCTGCAGTATAGATGGGATATGATGCATAGGCTT
GGAGAACCACAGGCAAGGATGAGAGAAGAGAATATGGAAAGGATTGGGGAGGAGGTGAGACAGCTGATGG
AAAAGCTGAGGGAAAAGCAGTTGAGTCATAGTCTGCGGGCAGTCAGCACTGACCCCCCTCACCATGACCA
TCATGATGAGTTTTGCCTTATGCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220965 representing NM_018476
Red=Cloning site Green=Tags(s)

MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRL
GEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018476
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018476.4
RefSeq Size 862 bp
RefSeq ORF 378 bp
Locus ID 55859
UniProt ID Q9HBH7
Cytogenetics Xq22
Domains BEX
Summary Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:BEX1 (NM_018476) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220965 BEX1 (Myc-DDK-tagged)-Human brain expressed, X-linked 1 (BEX1) 10 ug
$150.00
RC220965L1 Lenti ORF clone of Human brain expressed, X-linked 1 (BEX1), Myc-DDK-tagged 10 ug
$450.00
RC220965L2 Lenti ORF clone of Human brain expressed, X-linked 1 (BEX1), mGFP tagged 10 ug
$450.00
RC220965L3 Lenti ORF clone of Human brain expressed, X-linked 1 (BEX1), Myc-DDK-tagged 10 ug
$450.00
RC220965L4 Lenti ORF clone of Human brain expressed, X-linked 1 (BEX1), mGFP tagged 10 ug
$450.00
SC127703 BEX1 (untagged)-Human brain expressed, X-linked 1 (BEX1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.