PGEA1 (CBY1) (NM_015373) Human Tagged ORF Clone

SKU
RG220783
CBY1 (tGFP-tagged) - Human chibby homolog 1 (Drosophila) (CBY1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PGEA1
Synonyms arb1; C22orf2; CBY; Chibby1; HS508I15A; PGEA1; PIGEA-14; PIGEA14
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG220783 representing NM_015373
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTTTCTTTGGGAATACGTTCAGTCCGAAGAAGACACCTCCTCGGAAGTCGGCATCTCTCTCCAACC
TGCATTCTTTGGATCGATCAACCCGGGAGGTGGAGCTGGGCTTGGAATACGGATCCCCGACTATGAACCT
GGCAGGGCAAAGCCTGAAGTTTGAAAATGGCCAGTGGATAGCAGAGACAGGGGTTAGTGGCGGTGTGGAC
CGGAGGGAGGTTCAGCGCCTTCGCAGGCGGAACCAGCAGTTGGAGGAAGAGAACAATCTCTTGCGGCTGA
AAGTGGACATCTTATTAGACATGCTTTCAGAGTCCACTGCTGAATCCCACTTAATGGAGAAGGAACTGGA
TGAACTGAGGATCAGCCGGAAGAGAAAA


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220783 representing NM_015373
Red=Cloning site Green=Tags(s)

MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETGVSGGVD
RREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_015373
ORF Size 378 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015373.3, NP_056188.1
RefSeq Size 1147 bp
RefSeq ORF 381 bp
Locus ID 25776
UniProt ID Q9Y3M2
Cytogenetics 22q13.1
Protein Families Transcription Factors
Summary Beta-catenin is a transcriptional activator and oncoprotein involved in the development of several cancers. The protein encoded by this gene interacts directly with the C-terminal region of beta-catenin, inhibiting oncogenic beta-catenin-mediated transcriptional activation by competing with transcription factors for binding to beta-catenin. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PGEA1 (CBY1) (NM_015373) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220783 CBY1 (Myc-DDK-tagged)-Human chibby homolog 1 (Drosophila) (CBY1), transcript variant 1 10 ug
$150.00
RC220783L3 Lenti ORF clone of Human chibby homolog 1 (Drosophila) (CBY1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC220783L4 Lenti ORF clone of Human chibby homolog 1 (Drosophila) (CBY1), transcript variant 1, mGFP tagged 10 ug
$450.00
SC114725 CBY1 (untagged)-Human chibby homolog 1 (Drosophila) (CBY1), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.