MTCP1 (NM_001018025) Human Tagged ORF Clone

SKU
RG217513
MTCP1 (tGFP-tagged) - Human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MTCP1
Synonyms p8MTCP1; P13MTCP1; TCL1C
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG217513 representing NM_001018025
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGAGAGGATGTGGGGGCTCCACCCGATCACCTCTGGGTTCACCAAGAGGGTATCTACCGCGACG
AATACCAGCGCACGTGGGTGGCCGTCGTGGAAGAGGAGACGAGTTTCCTAAGGGCACGAGTCCAGCAAAT
TCAGGTTCCCTTAGGTGACGCAGCTAGGCCAAGTCACCTTCTTACCTCCCAGCTACCTCTCATGTGGCAA
CTCTACCCGGAGGAGCGCTACATGGATAACAACTCTCGCTTGTGGCAGATACAGCATCATTTAATGGTCA
GGGGAGTACAGGAGCTGTTGCTTAAGCTTTTGCCTGATGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG217513 representing NM_001018025
Red=Cloning site Green=Tags(s)

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQ
LYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001018025
ORF Size 321 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001018025.4
RefSeq Size 1943 bp
RefSeq ORF 324 bp
Locus ID 4515
UniProt ID P56278
Cytogenetics Xq28
Summary This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:MTCP1 (NM_001018025) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217513 MTCP1 (Myc-DDK-tagged)-Human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein 10 ug
$150.00
RC217513L1 Lenti ORF clone of Human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC217513L2 Lenti ORF clone of Human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
RC217513L3 Lenti ORF clone of Human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC217513L4 Lenti ORF clone of Human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
SC302131 MTCP1 (untagged)-Human mature T-cell proliferation 1 (MTCP1), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.