CEACAM3 (NM_001815) Human Tagged ORF Clone

SKU
RG217469
CEACAM3 (tGFP-tagged) - Human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CEACAM3
Synonyms CD66D; CEA; CGM1; W264; W282
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG217469 representing NM_001815
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCCCCCCTCAGCCTCTCCCCACAGAGAATGCATCCCCTGGCAGGGGCTTCTGCTCACAGCCTCAC
TTCTAAACTTCTGGAACCCGCCCACCACTGCCAAGCTCACTATTGAATCCATGCCGCTCAGTGTCGCAGA
GGGGAAGGAGGTGCTTCTACTTGTCCACAATCTGCCCCAGCATCTTTTTGGCTACAGCTGGTACAAAGGG
GAAAGAGTGGATGGCAACAGTCTAATTGTAGGATATGTAATAGGAACTCAACAAGCTACCCCAGGGGCCG
CATACAGCGGTCGAGAGACAATATACACCAATGCATCCCTGCTGATCCAGAATGTCACCCAGAATGACAT
AGGATTCTACACCCTACAAGTCATAAAGTCAGATCTTGTGAATGAAGAAGCAACTGGACAGTTCCATGTA
TACCAAGAAAATGCCCCAGGCCTTCCTGTGGGGGCCGTCGCCGGCATCGTGACCGGGGTCCTGGTCGGAG
TGGCGCTGGTGGCCGCGCTGGTGTGTTTCCTGCTCCTTGCCAAAACTGGAAGAACCAGCATCCAGCGTGA
CCTCAAGGAGCAGCAGCCCCAAGCCCTTGCCCCTGGCCGTGGTCCCTCCCACAGCTCTGCCTTCTCGATG
TCCCCTCTCTCCACTGCCCAGGCCCCCCTACCCAACCCCAGGACAGCAGCTTCCATCTATGAGGAATTGC
TAAAACATGACACAAACATTTACTGCCGGATGGACCACAAAGCAGAAGTGGCTTCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG217469 representing NM_001815
Red=Cloning site Green=Tags(s)

MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKG
ERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHV
YQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSM
SPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001815
ORF Size 756 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001815.5
RefSeq Size 1151 bp
RefSeq ORF 759 bp
Locus ID 1084
UniProt ID P40198
Cytogenetics 19q13.2
Protein Families Transmembrane
Summary This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2013]
Write Your Own Review
You're reviewing:CEACAM3 (NM_001815) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217469 CEACAM3 (Myc-DDK-tagged)-Human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) 10 ug
$450.00
RC217469L1 Lenti ORF clone of Human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3), Myc-DDK-tagged 10 ug
$750.00
RC217469L2 Lenti ORF clone of Human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3), mGFP tagged 10 ug
$750.00
RC217469L3 Lenti ORF clone of Human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3), Myc-DDK-tagged 10 ug
$750.00
RC217469L4 Lenti ORF clone of Human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3), mGFP tagged 10 ug
$750.00
SC317359 CEACAM3 (untagged)-Human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.