NIPP1 (PPP1R8) (NM_002713) Human Tagged ORF Clone

SKU
RG216856
PPP1R8 (tGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$365.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NIPP1
Synonyms ARD-1; ARD1; NIPP-1; NIPP1; PRO2047
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG216856 representing NM_002713
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGCAAACTGCAGTGGTCCCAGTCAAGAAGAAGCGTGTGGAGGGCCCTGGCTCCCTGGGCCTGGAGG
AATCAGGGAGCAGGCGCATGCAGAACTTTGCCTTCAGCGGAGGACTCTACGGGGGCCTGCCCCCCACACA
CAGTGAAGCAGGCTCCCAGCCACATGGCATCCATGGGACAGCACTCATCGGTGGCTTGCCCATGCCATAC
CCAAACCTTGCCCCTGATGTGGACTTGACTCCTGTTGTGCCGTCAGCAGTGAACATGAACCCTGCACCAA
ACCCTGCAGTCTATAACCCTGAAGCTGTAAATGAACCCAAGAAGAAGAAATATGCAAAAGAGGCTTGGCC
AGGCAAGAAGCCCACACCTTCCTTGCTGATT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG216856 representing NM_002713
Red=Cloning site Green=Tags(s)

MVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPY
PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002713
ORF Size 381 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002713.4
RefSeq Size 2558 bp
RefSeq ORF 384 bp
Locus ID 5511
UniProt ID Q12972
Cytogenetics 1p35.3
Protein Families Druggable Genome, Transcription Factors
Summary This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NIPP1 (PPP1R8) (NM_002713) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216856 PPP1R8 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3 10 ug
$165.00
RC216856L3 Lenti-ORF clone of PPP1R8 (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3 10 ug
$465.00
RC216856L4 Lenti-ORF clone of PPP1R8 (mGFP-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3 10 ug
$465.00
SC124701 PPP1R8 (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 8 (PPP1R8), transcript variant 3 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.