CD42c (GP1BB) (NM_000407) Human Tagged ORF Clone

SKU
RG216738
GP1BB (tGFP-tagged) - Human glycoprotein Ib (platelet), beta polypeptide (GP1BB)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD42c
Synonyms BDPLT1; BS; CD42C; GPIBB; GPIbbeta
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG216738 representing NM_000407
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTCCGGGCCGCGCGGGGCGCTGAGCTTACTGCTCCTGCTGCTGGCCCCGCCGAGCCGCCCGGCCG
CAGGTTGCCCGGCGCCCTGTAGCTGCGCGGGGACGCTCGTGGACTGCGGGCGCCGCGGGCTGACTTGGGC
CTCGCTGCCGACCGCCTTCCCTGTCGACACAACCGAGCTGGTGCTGACCGGCAACAACCTGACGGCGCTG
CCGCCGGGGCTGCTGGACGCGCTGCCCGCGCTGCGCACCGCACACCTGGGCGCCAACCCCTGGCGCTGCG
ACTGCCGCCTTGTGCCGCTGCGCGCCTGGCTGGCCGGCCGCCCCGAGCGTGCGCCCTACCGCGACCTGCG
TTGCGTGGCGCCCCCAGCGCTGCGCGGCCGCCTGCTGCCCTATCTGGCCGAGGACGAGCTGCGCGCCGCT
TGCGCTCCCGGCCCGCTCTGCTGGGGGGCGCTGGCGGCGCAGCTTGCGCTGCTGGGCCTTGGGCTGCTGC
ACGCGTTGCTGCTGGTGCTGCTGCTGTGCCGCCTGCGGAGGCTGCGGGCCCGGGCCCGCGCTCGCGCCGC
AGCCCGGCTGTCGCTGACCGACCCGCTGGTGGCCGAGCGAGCCGGAACCGACGAGTCC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG216738 representing NM_000407
Red=Cloning site Green=Tags(s)

MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTAL
PPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAA
CAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_000407
ORF Size 618 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000407.5
RefSeq Size 955 bp
RefSeq ORF 621 bp
Locus ID 2812
UniProt ID P13224
Cytogenetics 22q11.21
Domains LRR, LRRCT, LRRNT
Protein Families Druggable Genome, Transmembrane
Protein Pathways ECM-receptor interaction, Hematopoietic cell lineage
Summary Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alpha chain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain. Mutations in the GPIb beta subunit have been associated with Bernard-Soulier syndrome, velocardiofacial syndrome and giant platelet disorder. The 206 amino acid precursor of GPIb beta is synthesized from a 1.0 kb mRNA expressed in plateletes and megakaryocytes. A 411 amino acid protein arising from a longer, unspliced transcript in endothelial cells has been described; however, the authenticity of this product has been questioned. Yet another less abundant GPIb beta mRNA species of 3.5 kb, expressed in nonhematopoietic tissues such as endothelium, brain and heart, was shown to result from inefficient usage of a non-consensus polyA signal in the neighboring upstream gene (SEPT5, septin 5). In the absence of polyadenylation from its own imperfect site, the SEPT5 gene produces read-through transcripts that use the consensus polyA signal of this gene. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:CD42c (GP1BB) (NM_000407) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216738 GP1BB (Myc-DDK-tagged)-Human glycoprotein Ib (platelet), beta polypeptide (GP1BB) 10 ug
$289.00 MSRP $300.00 MSRP $300.00
RC216738L3 Lenti-ORF clone of GP1BB (Myc-DDK-tagged)-Human glycoprotein Ib (platelet), beta polypeptide (GP1BB) 10 ug
$600.00
RC216738L4 Lenti-ORF clone of GP1BB (mGFP-tagged)-Human glycoprotein Ib (platelet), beta polypeptide (GP1BB) 10 ug
$600.00
SC119912 GP1BB (untagged)-Human glycoprotein Ib (platelet), beta polypeptide (GP1BB) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.