GALP (NM_033106) Human Tagged ORF Clone

SKU
RG216301
GALP (tGFP-tagged) - Human galanin-like peptide (GALP), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GALP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG216301 representing NM_033106
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCTCCCTCCGTCCCCCTGGTCCTCCTCCTCGTCCTCTTGCTGAGCCTGGCAGAGACTCCAGCAT
CCGCACCTGCCCACCGGGGACGAGGAGGCTGGACCCTCAATAGTGCTGGCTACCTTCTGGGTCCCGTCCT
CCACCTTCCCCAAATGGGTGACCAAGACGGAAAGAGGGAGACAGCCCTTGAGATCCTAGACCTGTGGAAG
GCCATCGACGGGCTCCCCTACTCCCACCCTCCACAGCCCTCCAAGAGGAATGTGATGGAGACGTTTGCCA
AACCAGAGATTGGAGATCTGGGCATGCTCAGCATGAAAATTCCCAAGGAGGAAGATGTCCTGAAGTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG216301 representing NM_033106
Red=Cloning site Green=Tags(s)

MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWK
AIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033106
ORF Size 348 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033106.4
RefSeq Size 947 bp
RefSeq ORF 351 bp
Locus ID 85569
UniProt ID Q9UBC7
Cytogenetics 19q13.43
Protein Families Secreted Protein
Summary This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, has vasoactive properties, displays antimicrobial activity against E. coli, and may serve as a marker for neuroblastic tumors.[provided by RefSeq, Nov 2014]
Write Your Own Review
You're reviewing:GALP (NM_033106) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216301 GALP (Myc-DDK-tagged)-Human galanin-like peptide (GALP), transcript variant 1 10 ug
$150.00
RC216301L1 Lenti ORF clone of Human galanin-like peptide (GALP), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC216301L2 Lenti ORF clone of Human galanin-like peptide (GALP), transcript variant 1, mGFP tagged 10 ug
$450.00
RC216301L3 Lenti ORF clone of Human galanin-like peptide (GALP), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC216301L4 Lenti ORF clone of Human galanin-like peptide (GALP), transcript variant 1, mGFP tagged 10 ug
$450.00
SC305561 GALP (untagged)-Human galanin-like peptide (GALP), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.