LARP6 (NM_197958) Human Tagged ORF Clone

SKU
RG215460
LARP6 (tGFP-tagged) - Human La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LARP6
Synonyms ACHN
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG215460 representing NM_197958
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAGTCCGGCGGGGAGGCTCGGCCCGGGCCCAAGACGGCGGTGCAGATCCGCGTCGCCATCCAGG
AGGCCGAGGACGTGGACGAGTTGGAGGACGAGGAGGAGGGGGCGGAGACTCGGGGCGCCGGGGACCCGGC
CCGGTACCTCAGCCCCGGCTGGGGCAGCGCGAGCGAGGAGGAGCCGAGCCGCGGGCACAGGAATAGGAGC
TCGGTGAATTCAAGGACCATGCTTGCTTCGTTCATTGTATCTTCAGCACCTAGCACAGCACCCAGCACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG215460 representing NM_197958
Red=Cloning site Green=Tags(s)

MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAGDPARYLSPGWGSASEEEPSRGHRNRS
SVNSRTMLASFIVSSAPSTAPST

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_197958
ORF Size 279 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_197958.3
RefSeq Size 577 bp
RefSeq ORF 282 bp
Locus ID 55323
UniProt ID Q9BRS8
Cytogenetics 15q23
Summary Regulates the coordinated translation of type I collagen alpha-1 and alpha-2 mRNAs, CO1A1 and CO1A2. Stabilizes mRNAs through high-affinity binding of a stem-loop structure in their 5' UTR. This regulation requires VIM and MYH10 filaments, and the helicase DHX9.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LARP6 (NM_197958) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215460 LARP6 (Myc-DDK-tagged)-Human La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2 10 ug
$150.00
RC215460L1 Lenti ORF clone of Human La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC215460L2 Lenti ORF clone of Human La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2, mGFP tagged 10 ug
$450.00
RC215460L3 Lenti ORF clone of Human La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC215460L4 Lenti ORF clone of Human La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2, mGFP tagged 10 ug
$450.00
SC307619 LARP6 (untagged)-Human La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.