APOL3 (NM_145642) Human Tagged ORF Clone

SKU
RG215191
APOL3 (tGFP-tagged) - Human apolipoprotein L, 3 (APOL3), transcript variant beta/b
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol APOL3
Synonyms apoL-III; APOLIII; CG12_1; CG121
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG215191 representing NM_145642
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCTTGCTGGTCTTGTTTTGGCACCATTTACAGCAGGGACGAGTCTGGCCCTTACTGCAGCTGGGG
TAGGGCTGGGAGCAGCGTCTGCTGTGACTGGGATCACCACCAGCATCGTGGAGCACTCATACACATCATC
AGCAGAAGCTGAAGCCAGCAGGCTGACTGCAACCAGCATTGACCGATTGAAGGTATTTAAGGAAGTTATG
CGTGACATCACACCCAACTTACTTTCCCTTCTTAATAATTATTACGAAGCCACACAAACCATTGGGAGTG
AAATCCGTGCCATCAGGCAAGCCAGAGCCAGGGCCCGACTCCCTGTGACCACCTGGCGAATCTCAGCTGG
AAGTGGTGGTCAAGCAGAGAGAACGATTGCAGGCACCACCCGGGCAGTGAGCAGAGGAGCCCGGATCCTG
AGTGCGACCACTTCAGGCATCTTCCTTGCACTGGATGTGGTCAACCTTGTATACGAGTCAAAGCACTTGC
ATGAGGGGGCAAAGTCTGCATCTGCTGAGGAGCTGAGGCGGCAGGCTCAGGAGCTGGAGGAGAATCTAAT
GGAGCTCACTCAGATCTATCAGCGTCTGAATCCATGCCATACCCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG215191 representing NM_145642
Red=Cloning site Green=Tags(s)

MSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVM
RDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARIL
SATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145642
ORF Size 606 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145642.2
RefSeq Size 3564 bp
RefSeq ORF 609 bp
Locus ID 80833
UniProt ID O95236
Cytogenetics 22q12.3
Summary This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]
Write Your Own Review
You're reviewing:APOL3 (NM_145642) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215191 APOL3 (Myc-DDK-tagged)-Human apolipoprotein L, 3 (APOL3), transcript variant beta/b 10 ug
$300.00
RC215191L1 Lenti ORF clone of Human apolipoprotein L, 3 (APOL3), transcript variant beta/b, Myc-DDK-tagged 10 ug
$600.00
RC215191L2 Lenti ORF clone of Human apolipoprotein L, 3 (APOL3), transcript variant beta/b, mGFP tagged 10 ug
$600.00
RC215191L3 Lenti ORF clone of Human apolipoprotein L, 3 (APOL3), transcript variant beta/b, Myc-DDK-tagged 10 ug
$600.00
RC215191L4 Lenti ORF clone of Human apolipoprotein L, 3 (APOL3), transcript variant beta/b, mGFP tagged 10 ug
$600.00
SC124455 APOL3 (untagged)-Human apolipoprotein L, 3 (APOL3), transcript variant beta/b 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.