MRAS (NM_012219) Human Tagged ORF Clone

SKU
RG212259
MRAS (tGFP-tagged) - Human muscle RAS oncogene homolog (MRAS), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MRAS
Synonyms M-RAs; NS11; R-RAS3; RRAS3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG212259 representing NM_012219
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAACCAGCGCCGTCCCCAGTGACAACCTCCCCACATACAAGCTGGTGGTGGTGGGGGATGGGGGTG
TGGGCAAAAGTGCCCTCACCATCCAGTTTTTCCAGAAGATCTTTGTGCCTGACTATGACCCCACCATTGA
AGACTCCTACCTGAAACATACGGAGATTGACAATCAATGGGCCATCTTGGACGTTCTGGACACAGCTGGG
CAGGAGGAATTCAGCGCCATGCGGGAGCAATACATGCGCACGGGGGATGGCTTCCTCATCGTCTACTCCG
TCACTGACAAGGCCAGCTTTGAGCACGTGGACCGCTTCCACCAGCTTATCCTGCGCGTCAAAGACAGGGA
GTCATTCCCGATGATCCTCGTGGCCAACAAGGTCGATTTGATGCACTTGAGGAAGATCACCAGGGAGCAA
GGAAAAGAAATGGCGACCAAACACAATACTCCGTACATAGAAACCAGTGCCAAGGACCCACCTCTCAATG
TCGACAAAGCCTTCCATGACCTCGTTAGAGTAATTAGGCAACAGATTCCGGAAAAAAGCCAGAAGAAGAA
GAAGAAAACCAAATGGCGGGGAGACCGGGCCACAGGCACCCACAAACTGCAATGTGTGATCTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG212259 representing NM_012219
Red=Cloning site Green=Tags(s)

MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG
QEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQ
GKEMATKHNTPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012219
ORF Size 624 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012219.4
RefSeq Size 3926 bp
RefSeq ORF 627 bp
Locus ID 22808
UniProt ID O14807
Cytogenetics 3q22.3
Domains RAB, RAN, RAS, ras, RHO
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction
Summary This gene encodes a member of the Ras family of small GTPases. These membrane-associated proteins function as signal transducers in multiple processes including cell growth and differentiation, and dysregulation of Ras signaling has been associated with many types of cancer. The encoded protein may play a role in the tumor necrosis factor-alpha and MAP kinase signaling pathways. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
Write Your Own Review
You're reviewing:MRAS (NM_012219) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212259 MRAS (Myc-DDK-tagged)-Human muscle RAS oncogene homolog (MRAS), transcript variant 1 10 ug
$289.00 MSRP $300.00 MSRP $300.00
RC212259L3 Lenti-ORF clone of MRAS (Myc-DDK-tagged)-Human muscle RAS oncogene homolog (MRAS), transcript variant 1 10 ug
$600.00
RC212259L4 Lenti-ORF clone of MRAS (mGFP-tagged)-Human muscle RAS oncogene homolog (MRAS), transcript variant 1 10 ug
$600.00
SC115494 MRAS (untagged)-Human muscle RAS oncogene homolog (MRAS), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.