BAFF Receptor (TNFRSF13C) (NM_052945) Human Tagged ORF Clone

SKU
RG211270
TNFRSF13C (tGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 13C (TNFRSF13C)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BAFF Receptor
Synonyms BAFF-R; BAFFR; BROMIX; CD268; CVID4; prolixin
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG211270 representing NM_052945
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCGAGGGCCCCGGAGCCTGCGGGGCAGGGACGCGCCAGCCCCCACGCCCTGCGTCCCGGCCGAGT
GCTTCGACCTGCTGGTCCGCCACTGCGTGGCCTGCGGGCTCCTGCGCACGCCGCGGCCGAAACCGGCCGG
GGCCAGCAGCCCTGCGCCCAGGACGGCGCTGCAGCCGCAGGAGTCGGTGGGCGCGGGGGCCGGCGAGGCG
GCGCTGCCCCTGCCCGGGCTGCTCTTTGGCGCCCCCGCGCTGCTGGGCCTGGCACTGGTCCTGGCGCTGG
TCCTGGTGGGTCTGGTGAGCTGGAGGCGGCGACAGCGGCGGCTTCGCGGCGCGTCCTCCGCAGAGGCCCC
CGACGGAGACAAGGACGCCCCAGAGCCCCTGGACAAGGTCATCATTCTGTCTCCGGGAATCTCTGATGCC
ACAGCTCCTGCCTGGCCTCCTCCTGGGGAAGACCCAGGAACCACCCCACCTGGCCACAGTGTCCCTGTGC
CAGCCACAGAGCTGGGCTCCACTGAACTGGTGACCACCAAGACGGCCGGCCCTGAGCAACAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG211270 representing NM_052945
Red=Cloning site Green=Tags(s)

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEA
ALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDA
TAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_052945
ORF Size 552 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_052945.4
RefSeq Size 898 bp
RefSeq ORF 555 bp
Locus ID 115650
UniProt ID Q96RJ3
Cytogenetics 22q13.2
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Primary immunodeficiency
Summary B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:BAFF Receptor (TNFRSF13C) (NM_052945) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211270 TNFRSF13C (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 13C (TNFRSF13C) 10 ug
$300.00
RC211270L1 Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 13C (TNFRSF13C), Myc-DDK-tagged 10 ug
$600.00
RC211270L2 Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 13C (TNFRSF13C), mGFP tagged 10 ug
$600.00
RC211270L3 Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 13C (TNFRSF13C), Myc-DDK-tagged 10 ug
$600.00
RC211270L4 Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 13C (TNFRSF13C), mGFP tagged 10 ug
$600.00
SC305701 TNFRSF13C (untagged)-Human tumor necrosis factor receptor superfamily, member 13C (TNFRSF13C) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.