OTOS (NM_148961) Human Tagged ORF Clone

SKU
RG211259
OTOS (tGFP-tagged) - Human otospiralin (OTOS)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OTOS
Synonyms OTOSP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG211259 representing NM_148961
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCCTGCATGGTGCCGGGGCTGGCCCTCTGCCTCCTACTGGGGCCTCTTGCAGGGGCCAAGCCTG
TGCAGGAGGAAGGAGACCCTTACGCGGAGCTGCCGGCCATGCCCTACTGGCCTTTCTCCACCTCTGACTT
CTGGAACTATGTGCAGCACTTCCAGGCCCTGGGGGCCTACCCCCAGATCGAGGACATGGCCCGAACCTTC
TTTGCCCACTTCCCCCTGGGGAGCACGCTGGGCTTCCACGTTCCCTATCAGGAGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG211259 representing NM_148961
Red=Cloning site Green=Tags(s)

MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTF
FAHFPLGSTLGFHVPYQED

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_148961
ORF Size 267 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_148961.4
RefSeq Size 566 bp
RefSeq ORF 270 bp
Locus ID 150677
UniProt ID Q8NHW6
Cytogenetics 2q37.3
Protein Families Secreted Protein
Summary Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness (Lavigne-Rebillard et al., 2003 [PubMed 12687421]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:OTOS (NM_148961) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211259 OTOS (Myc-DDK-tagged)-Human otospiralin (OTOS) 10 ug
$150.00
RC211259L3 Lenti ORF clone of Human otospiralin (OTOS), Myc-DDK-tagged 10 ug
$450.00
RC211259L4 Lenti ORF clone of Human otospiralin (OTOS), mGFP tagged 10 ug
$450.00
SC306339 OTOS (untagged)-Human otospiralin (OTOS) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.