Tuberoinfundibular peptide (PTH2) (NM_178449) Human Tagged ORF Clone

SKU
RG210906
PTH2 (tGFP-tagged) - Human parathyroid hormone 2 (PTH2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Tuberoinfundibular peptide
Synonyms TIP39
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210906 representing NM_178449
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACCCGCCAGGTGTCCAGGAGCCCTCGGGTTCGGCTGCTGCTGCTGCTGCTGCTGCTGCTGGTGG
TGCCCTGGGGCGTCCGCACTGCCTCGGGAGTCGCCCTGCCCCCGGTCGGGGTCCTCAGCCTCCGCCCCCC
AGGACGGGCCTGGGCGGATCCCGCCACCCCCAGGCCGCGGAGGAGCCTGGCGCTGGCGGACGACGCGGCC
TTCCGGGAGCGCGCGCGGTTGCTGGCCGCCCTCGAGCGCCGCCACTGGCTGAACTCGTACATGCACAAGC
TGCTGGTGTTGGATGCGCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210906 representing NM_178449
Red=Cloning site Green=Tags(s)

METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAA
FRERARLLAALERRHWLNSYMHKLLVLDAP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178449
ORF Size 300 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178449.4
RefSeq Size 459 bp
RefSeq ORF 303 bp
Locus ID 113091
UniProt ID Q96A98
Cytogenetics 19q13.33
Protein Families Secreted Protein, Transmembrane
Summary This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception. The encoded precursor protein is proteolytically processed to generate the biologically active neuropeptide. [provided by RefSeq, Jul 2015]
Write Your Own Review
You're reviewing:Tuberoinfundibular peptide (PTH2) (NM_178449) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210906 PTH2 (Myc-DDK-tagged)-Human parathyroid hormone 2 (PTH2) 10 ug
$150.00
RC210906L1 Lenti ORF clone of Human parathyroid hormone 2 (PTH2), Myc-DDK-tagged 10 ug
$450.00
RC210906L2 Lenti ORF clone of Human parathyroid hormone 2 (PTH2), mGFP tagged 10 ug
$450.00
RC210906L3 Lenti ORF clone of Human parathyroid hormone 2 (PTH2), Myc-DDK-tagged 10 ug
$450.00
RC210906L4 Lenti ORF clone of Human parathyroid hormone 2 (PTH2), mGFP tagged 10 ug
$450.00
SC307181 PTH2 (untagged)-Human parathyroid hormone 2 (PTH2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.