Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Tagged ORF Clone

SKU
RG210717
PSMA5 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Proteasome 20S alpha 5
Synonyms PSC5; ZETA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210717 representing NM_002790
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTCTTACCCGGTCTGAGTACGACAGGGGCGTGAATACTTTTTCTCCCGAAGGAAGATTATTTCAAG
TGGAATATGCCATTGAGGCTATCAAGCTTGGTTCTACAGCCATTGGGATCCAGACATCAGAGGGTGTGTG
CCTAGCTGTGGAGAAGAGAATTACTTCCCCACTGATGGAGCCCAGCAGCATTGAGAAAATTGTAGAGATT
GATGCTCACATAGGTTGTGCCATGAGTGGGCTAATTGCTGATGCTAAGACTTTAATTGATAAAGCCAGAG
TGGAGACACAGAACCACTGGTTCACCTACAATGAGACAATGACAGTGGAGAGTGTGACCCAAGCTGTGTC
CAATCTGGCTTTGCAGTTTGGAGAAGAAGATGCAGATCCAGGTGCCATGTCTCGTCCCTTTGGAGTAGCA
TTATTATTTGGAGGAGTTGATGAGAAAGGACCCCAGCTGTTTCATATGGACCCATCTGGGACCTTTGTAC
AGTGTGATGCTCGAGCAATTGGCTCTGCTTCAGAGGGTGCCCAGAGCTCCTTGCAAGAAGTTTACCACAA
GTCTATGACTTTGAAAGAAGCCATCAAGTCTTCACTCATCATCCTCAAACAAGTAATGGAGGAGAAGCTG
AATGCAACAAACATTGAGCTAGCCACAGTGCAGCCTGGCCAGAATTTCCACATGTTCACAAAGGAAGAAC
TTGAAGAGGTTATCAAGGACATT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210717 representing NM_002790
Red=Cloning site Green=Tags(s)

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI
DAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVA
LLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKL
NATNIELATVQPGQNFHMFTKEELEEVIKDI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002790
ORF Size 723 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002790.4
RefSeq Size 1023 bp
RefSeq ORF 726 bp
Locus ID 5686
UniProt ID P28066
Cytogenetics 1p13.3
Domains proteasome
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:Proteasome 20S alpha 5 (PSMA5) (NM_002790) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210717 PSMA5 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1 10 ug
$300.00
RC210717L3 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210717L4 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1, mGFP tagged 10 ug
$600.00
SC118413 PSMA5 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1 10 ug
$300.00
SC322079 PSMA5 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.