PRH2 (NM_005042) Human Tagged ORF Clone

SKU
RG210681
PRH2 (tGFP-tagged) - Human proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PRH2
Synonyms db-s; pa; PIF-S; Pr; pr1/Pr2; PRH1; PRP-1/PRP-2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210681 representing NM_005042
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTCTGATTCTGCTGTCAGTGGCCCTGCTGGCCTTCAGCTCAGCTCAGGACTTAGATGAAGATGTCA
GCCAAGAAGACGTTCCCTTGGTAATATCAGATGGAGGAGACTCTGAGCAGTTCATAGATGAGGAGCGTCA
GGGACCACCTTTGGGAGGACAGCAATCTCAACCCTCTGCTGGTGATGGGAACCAGGATGATGGCCCTCAG
CAGGGACCACCCCAACAAGGAGGCCAGCAGCAACAAGGTCCACCACCTCCTCAGGGAAAGCCACAAGGAC
CACCCCAACAGGGAGGCCATCCCCCTCCTCCTCAAGGAAGGCCACAAGGACCACCCCAACAGGGAGGCCA
TCCCCGTCCTCCTCGAGGAAGGCCACAAGGACCACCCCAACAGGGAGGCCATCAGCAAGGTCCTCCCCCA
CCTCCTCCTGGAAAGCCCCAGGGACCACCTCCCCAAGGGGGCCGCCCACAAGGACCTCCACAGGGGCAGT
CTCCTCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210681 representing NM_005042
Red=Cloning site Green=Tags(s)

MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQDDGPQ
QGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPP
PPPGKPQGPPPQGGRPQGPPQGQSPQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005042
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005042.2, NP_005033.1
RefSeq Size 3290 bp
RefSeq ORF 501 bp
Locus ID 5555
Cytogenetics 12p13.2
Protein Families Secreted Protein
Summary This gene encodes a member of the heterogeneous family of proline-rich salivary glycoproteins. The encoded preproprotein undergoes proteolytic processing to generate one or more mature isoforms before secretion from the parotid and submandibular/sublingual glands. In western population this locus is commonly biallelic and encodes proline-rich protein (PRP) isoforms, PRP-1 and PRP-2. The reference genome encodes the PRP-1 allele. Certain alleles of this gene are associated with susceptibility to dental caries. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:PRH2 (NM_005042) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210681 PRH2 (Myc-DDK-tagged)-Human proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1 10 ug
$150.00
RC210681L1 Lenti ORF clone of Human proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC210681L2 Lenti ORF clone of Human proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1, mGFP tagged 10 ug
$450.00
RC210681L3 Lenti ORF clone of Human proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC210681L4 Lenti ORF clone of Human proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1, mGFP tagged 10 ug
$450.00
SC303565 PRH2 (untagged)-Human proline-rich protein HaeIII subfamily 2 (PRH2), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.