ARPP19 (NM_006628) Human Tagged ORF Clone

SKU
RG210574
ARPP19 (tGFP-tagged) - Human cAMP-regulated phosphoprotein, 19kDa (ARPP19)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ARPP19
Synonyms ARPP-16; ARPP-19; ARPP16; ENSAL
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210574 representing NM_006628
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGCGGAAGTCCCCGAGGCAGCCTCCGCGGAGGAGCAGAAGGAAATGGAAGATAAAGTGACTAGTC
CAGAGAAAGCAGAAGAAGCAAAATTAAAAGCAAGATATCCTCATCTGGGACAAAAGCCTGGAGGTTCAGA
TTTCTTAAGGAAACGGTTGCAGAAAGGGCAAAAATATTTTGATTCTGGGGATTACAACATGGCTAAAGCA
AAAATGAAGAACAAGCAACTTCCTACTGCAGCTCCGGATAAGACGGAGGTCACTGGTGACCACATTCCCA
CTCCGCAAGACCTTCCTCAACGGAAGCCGTCCCTTGTTGCTAGCAAGCTGGCTGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210574 representing NM_006628
Red=Cloning site Green=Tags(s)

MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKA
KMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006628
ORF Size 336 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006628.6
RefSeq Size 5162 bp
RefSeq ORF 339 bp
Locus ID 10776
UniProt ID P56211
Cytogenetics 15q21.2
Domains endosulfine
Protein Families Druggable Genome
Summary The 19-kD cAMP-regulated phosphoprotein plays a role in regulating mitosis by inhibiting protein phosphatase-2A (PP2A; see MIM 176915) (summary by Gharbi-Ayachi et al., 2010 [PubMed 21164014]).[supplied by OMIM, Feb 2011]
Write Your Own Review
You're reviewing:ARPP19 (NM_006628) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210574 ARPP19 (Myc-DDK-tagged)-Human cAMP-regulated phosphoprotein, 19kDa (ARPP19) 10 ug
$150.00
RC210574L1 Lenti ORF clone of Human cAMP-regulated phosphoprotein, 19kDa (ARPP19), Myc-DDK-tagged 10 ug
$450.00
RC210574L2 Lenti ORF clone of Human cAMP-regulated phosphoprotein, 19kDa (ARPP19), mGFP tagged 10 ug
$450.00
RC210574L3 Lenti ORF clone of Human cAMP-regulated phosphoprotein, 19kDa (ARPP19), Myc-DDK-tagged 10 ug
$450.00
RC210574L4 Lenti ORF clone of Human cAMP-regulated phosphoprotein, 19kDa (ARPP19), mGFP tagged 10 ug
$450.00
SC115993 ARPP19 (untagged)-Human cAMP-regulated phosphoprotein, 19kDa (ARPP19) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.