SPTSSB (NM_001040100) Human Tagged ORF Clone

SKU
RG210453
SPTSSB (tGFP-tagged) - Human chromosome 3 open reading frame 57 (C3orf57)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SPTSSB
Synonyms ADMP; C3orf57; SSSPTB
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210453 representing NM_001040100
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTTGAGGCGTGTGAAGGAATATTTCTCCTGGCTCTACTATCAATACCAAATCATTAGCTGCTGTG
CTGTTTTAGAGCCCTGGGAGCGATCTATGTTTAACACCATCTTACTAACCATTATTGCTATGGTGGTATA
CACTGCCTATGTCTTTATTCCAATCCACATTCGCCTGGCTTGGGAATTTTTCTCAAAAATATGTGGATAT
CACAGTACAATTTCTAAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210453 representing NM_001040100
Red=Cloning site Green=Tags(s)

MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY
HSTISN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001040100
ORF Size 228 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001040100.1, NP_001035189.1
RefSeq Size 2306 bp
RefSeq ORF 231 bp
Locus ID 165679
UniProt ID Q8NFR3
Cytogenetics 3q26.1
Protein Families Transmembrane
Summary Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010]
Write Your Own Review
You're reviewing:SPTSSB (NM_001040100) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210453 SPTSSB (Myc-DDK-tagged)-Human chromosome 3 open reading frame 57 (C3orf57) 10 ug
$150.00
RC210453L3 Lenti ORF clone of Human chromosome 3 open reading frame 57 (C3orf57), Myc-DDK-tagged 10 ug
$450.00
RC210453L4 Lenti ORF clone of Human chromosome 3 open reading frame 57 (C3orf57), mGFP tagged 10 ug
$450.00
SC310957 SPTSSB (untagged)-Human chromosome 3 open reading frame 57 (C3orf57) 10 ug
$165.00
SC321041 SPTSSB (untagged)-Human chromosome 3 open reading frame 57 (C3orf57) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.