Diffuse panbronchiolitis critical region protein 1 (DPCR1) (NM_080870) Human Tagged ORF Clone

SKU
RG210155
DPCR1 (tGFP-tagged) - Human diffuse panbronchiolitis critical region 1 (DPCR1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Diffuse panbronchiolitis critical region protein 1
Synonyms C6orf37; DPCR1; PBLT
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210155 representing NM_080870
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACACAAGTCACAGAAAAGTCCACAGAACACCCAGAAAAGACCACGTCAACCACAGAGAAAACCACAA
GAACCCCAGAAAAGCCTACGCTATACTCAGAGAAGACCATATGCACCAAAGGGAAAAACACACCAGTCCC
AGAAAAGCCTACAGAAAACCTGGGGAACACCACACTGACCACTGAGACCATAAAAGCCCCAGTAAAGTCC
ACAGAAAACCCAGAAAAAACAGCAGCAGTCACAAAGACTATAAAACCTTCAGTCAAGGTCACAGGAGACA
AATCTCTCACTACTACCTCTTCTCATCTAAATAAAACTGAAGTTACTCATCAGGTGCCCACTGGTTCTTT
CACCCTCATTACATCTAGAACGAAGCTGAGTTCTATCACATCAGAAGCCACAGGAAACGAGAGCCATCCA
TACCTCAATAAAGATGGCTCACAGAAAGGTATCCACGCTGGACAGATGGGAGAGAATGATTCATTCCCTG
CATGGGCCATAGTTATTGTGGTCCTGGTGGCTGTGATTCTCCTCCTGGTGTTCCTTGGCCTGATCTTCTT
GGTCTCCTATATGATGCGGACACGCCGCACACTAACCCAGAACACCCAGTACAATGATGCAGAGGATGAG
GGTGGCCCCAATTCCTACCCGGTCTACCTGATGGAGCAGCAGAATCTTGGCATGGGCCAGATCCCTTCCC
CACGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210155 representing NM_080870
Red=Cloning site Green=Tags(s)

MTQVTEKSTEHPEKTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKS
TENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHP
YLNKDGSQKGIHAGQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTLTQNTQYNDAEDE
GGPNSYPVYLMEQQNLGMGQIPSPR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_080870
ORF Size 705 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080870.2, NP_543146.1
RefSeq Size 1989 bp
RefSeq ORF 4182 bp
Locus ID 135656
UniProt ID Q3MIW9
Cytogenetics 6p21.33
Protein Families Transmembrane
Summary May modulate NF-kappaB signaling and play a role in cell growth.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Diffuse panbronchiolitis critical region protein 1 (DPCR1) (NM_080870) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210155 DPCR1 (Myc-DDK-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$450.00
RC210155L1 Lenti-ORF clone of DPCR1 (Myc-DDK-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$750.00
RC210155L2 Lenti-ORF clone of DPCR1 (mGFP-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$750.00
RC210155L3 Lenti-ORF clone of DPCR1 (Myc-DDK-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$750.00
RC210155L4 Lenti-ORF clone of DPCR1 (mGFP-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$750.00
RC229438 DPCR1 (Myc-DDK-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$1,787.00
RC229438L1 Lenti-ORF clone of DPCR1 (Myc-DDK-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$2,087.00
RC229438L2 Lenti-ORF clone of DPCR1 (mGFP-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$2,087.00
RC229438L3 Lenti-ORF clone of DPCR1 (Myc-DDK-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$2,087.00
RC229438L4 Lenti-ORF clone of DPCR1 (mGFP-tagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$2,087.00
RG229438 DPCR1 (tGFP-tagged) - Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$1,987.00
SC305870 DPCR1 (untagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$480.00
SC328073 DPCR1 (untagged)-Human diffuse panbronchiolitis critical region 1 (DPCR1) 10 ug
$1,907.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.