IL9 (NM_000590) Human Tagged ORF Clone

SKU
RG209682
IL9 (tGFP-tagged) - Human interleukin 9 (IL9)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IL9
Synonyms HP40; IL-9; P40
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209682 representing NM_000590
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTCTGGCCATGGTCCTTACCTCTGCCCTGCTCCTGTGCTCCGTGGCAGGCCAGGGGTGTCCAACCT
TGGCGGGGATCCTGGACATCAACTTCCTCATCAACAAGATGCAGGAAGATCCAGCTTCCAAGTGCCACTG
CAGTGCTAATGTGACCAGTTGTCTCTGTTTGGGCATTCCCTCTGACAACTGCACCAGACCATGCTTCAGT
GAGAGACTGTCTCAGATGACCAATACCACCATGCAAACAAGATACCCACTGATTTTCAGTCGGGTGAAAA
AATCAGTTGAAGTACTAAAGAACAACAAGTGTCCATATTTTTCCTGTGAACAGCCATGCAACCAAACCAC
GGCAGGCAACGCGCTGACATTTCTGAAGAGTCTTCTGGAAATTTTCCAGAAAGAAAAGATGAGAGGGATG
AGAGGCAAGATA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209682 representing NM_000590
Red=Cloning site Green=Tags(s)

MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFS
ERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGM
RGKI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000590
ORF Size 432 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000590.2
RefSeq Size 591 bp
RefSeq ORF 435 bp
Locus ID 3578
UniProt ID P15248
Cytogenetics 5q31.1
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Asthma, Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
Summary The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:IL9 (NM_000590) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209682 IL9 (Myc-DDK-tagged)-Human interleukin 9 (IL9) 10 ug
$150.00
RC209682L3 Lenti ORF clone of Human interleukin 9 (IL9), Myc-DDK-tagged 10 ug
$450.00
RC209682L4 Lenti ORF clone of Human interleukin 9 (IL9), mGFP tagged 10 ug
$450.00
SC300105 IL9 (untagged)-Human interleukin 9 (IL9) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.