DPH4 (DNAJC24) (NM_181706) Human Tagged ORF Clone

SKU
RG209088
DNAJC24 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DPH4
Synonyms DPH4; JJJ3; ZCSL3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209088 representing NM_181706
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTTGAGCAGATGCCAAAAAAGGATTGGTACAGCATCCTGGGAGCAGACCCATCTGCAAATATAT
CAGACCTAAAACAAAAATATCAAAAACTCATATTAATGTATCATCCAGATAAACAAAGTACAGATGTACC
AGCAGGAACAGTGGAGGAATGTGTACAGAAGTTCATCGAAATTGATCAAGCATGGAAAATTCTAGGAAAT
GAAGAGACAAAAAGAGAGTATGACCTGCAGCGGTGTGAAGATGATCTAAGAAATGTAGGACCAGTAGATG
CTCAAGTATATCTTGAAGAAATGTCTTGGAATGAAGGTGATCACTCTTTTTATCTGAGTTGCAGATGTGG
TGGAAAATACAGTGTTTCCAAGGATGAAGCGGAAGAAGTTAGCCTGATTTCTTGTGATACATGTTCACTA
ATTATAGAACTCCTTCATTATAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209088 representing NM_181706
Red=Cloning site Green=Tags(s)

MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGN
EETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSL
IIELLHYN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181706
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181706.3, NP_859057.3
RefSeq Size 3000 bp
RefSeq ORF 450 bp
Locus ID 120526
UniProt ID Q6P3W2
Cytogenetics 11p13
Summary Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:DPH4 (DNAJC24) (NM_181706) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209088 DNAJC24 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24) 10 ug
$150.00
RC209088L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24), Myc-DDK-tagged 10 ug
$450.00
RC209088L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24), mGFP tagged 10 ug
$450.00
SC317246 DNAJC24 (untagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.