Cathelicidin (CAMP) (NM_004345) Human Tagged ORF Clone

SKU
RG208872
CAMP (tGFP-tagged) - Human cathelicidin antimicrobial peptide (CAMP)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cathelicidin
Synonyms CAP-18; CAP18; CRAMP; FALL-39; FALL39; HSD26; LL37
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208872 representing NM_004345
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACCCAAAGGGATGGCCACTCCCTGGGGCGGTGGTCACTGGTGCTCCTGCTGCTGGGCCTGGTGA
TGCCTCTGGCCATCATTGCCCAGGTCCTCAGCTACAAGGAAGCTGTGCTTCGTGCTATAGATGGCATCAA
CCAGCGGTCCTCGGATGCTAACCTCTACCGCCTCCTGGACCTGGACCCCAGGCCCACGATGGATGGGGAC
CCAGACACGCCAAAGCCTGTGAGCTTCACAGTGAAGGAGACAGTGTGCCCCAGGACGACACAGCAGTCAC
CAGAGGATTGTGACTTCAAGAAGGACGGGCTGGTGAAGCGGTGTATGGGGACAGTGACCCTCAACCAGGC
CAGGGGCTCCTTTGACATCAGTTGTGATAAGGATAACAAGAGATTTGCCCTGCTGGGTGATTTCTTCCGG
AAATCTAAAGAGAAGATTGGCAAAGAGTTTAAAAGAATTGTCCAGAGAATCAAGGATTTTTTGCGGAATC
TTGTACCCAGGACAGAGTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208872 representing NM_004345
Red=Cloning site Green=Tags(s)

MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGD
PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFR
KSKEKIGKEFKRIVQRIKDFLRNLVPRTES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004345
ORF Size 510 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004345.5
RefSeq Size 739 bp
RefSeq ORF 513 bp
Locus ID 820
UniProt ID P49913
Cytogenetics 3p21.31
Domains Cathelicidins
Protein Families Secreted Protein, Transmembrane
Summary This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:Cathelicidin (CAMP) (NM_004345) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208872 CAMP (Myc-DDK-tagged)-Human cathelicidin antimicrobial peptide (CAMP) 10 ug
$300.00
RC208872L1 Lenti ORF clone of Human cathelicidin antimicrobial peptide (CAMP), Myc-DDK-tagged 10 ug
$600.00
RC208872L2 Lenti ORF clone of Human cathelicidin antimicrobial peptide (CAMP), mGFP tagged 10 ug
$600.00
RC208872L3 Lenti ORF clone of Human cathelicidin antimicrobial peptide (CAMP), Myc-DDK-tagged 10 ug
$600.00
RC208872L4 Lenti ORF clone of Human cathelicidin antimicrobial peptide (CAMP), mGFP tagged 10 ug
$600.00
SC117446 CAMP (untagged)-Human cathelicidin antimicrobial peptide (CAMP) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.