LYZL6 (NM_020426) Human Tagged ORF Clone

SKU
RG208863
LYZL6 (tGFP-tagged) - Human lysozyme-like 6 (LYZL6), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LYZL6
Synonyms HEL-S-6a; LYC1; LYZB; PRO1485; TKAL754; UNQ754
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208863 representing NM_020426
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAAAGGCGCTACTCATCTATTTGGTCAGCAGCTTTCTTGCCCTAAATCAGGCCAGCCTCATCAGTC
GCTGTGACTTGGCCCAGGTGCTGCAGCTGGAGGACTTGGATGGGTTTGAGGGTTACTCCCTGAGTGACTG
GCTGTGCCTGGCTTTTGTGGAAAGCAAGTTCAACATATCAAAGATAAATGAAAATGCAGACGGAAGCTTT
GACTATGGCCTCTTCCAGATCAACAGCCACTACTGGTGCAACGATTATAAGAGTTACTCGGAAAACCTTT
GCCACGTAGACTGTCAAGATCTGCTGAATCCCAACCTTCTTGCAGGCATCCACTGCGCAAAAAGGATTGT
GTCCGGAGCACGGGGGATGAACAACTGGGTAGAATGGAGGTTGCACTGTTCAGGCCGGCCACTCTTCTAC
TGGCTGACAGGATGCCGCCTGAGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208863 representing NM_020426
Red=Cloning site Green=Tags(s)

MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSF
DYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFY
WLTGCRLR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020426
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020426.4
RefSeq Size 872 bp
RefSeq ORF 447 bp
Locus ID 57151
UniProt ID O75951
Cytogenetics 17q12
Protein Families Secreted Protein
Summary This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]
Write Your Own Review
You're reviewing:LYZL6 (NM_020426) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208863 LYZL6 (Myc-DDK-tagged)-Human lysozyme-like 6 (LYZL6), transcript variant 2 10 ug
$150.00
RC208863L3 Lenti ORF clone of Human lysozyme-like 6 (LYZL6), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC208863L4 Lenti ORF clone of Human lysozyme-like 6 (LYZL6), transcript variant 2, mGFP tagged 10 ug
$450.00
SC125833 LYZL6 (untagged)-Human lysozyme-like 6 (LYZL6), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.