CD3E (NM_000733) Human Tagged ORF Clone

SKU
RG208276
CD3E (tGFP-tagged) - Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD3E
Synonyms IMD18; T3E; TCRE
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208276 representing NM_000733
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTCGGGCACTCACTGGAGAGTTCTGGGCCTCTGCCTCTTATCAGTTGGTGTTTGGGGGCAAGATG
GTAATGAAGAAATGGGTGGTATTACACAGACACCATATAAAGTCTCCATCTCTGGAACCACAGTAATATT
GACATGCCCTCAGTATCCTGGATCTGAAATACTATGGCAACACAATGATAAAAACATAGGCGGTGATGAG
GATGATAAAAACATAGGCAGTGATGAGGATCACCTGTCACTGAAGGAATTTTCAGAATTGGAGCAAAGTG
GTTATTATGTCTGCTACCCCAGAGGAAGCAAACCAGAAGATGCGAACTTTTATCTCTACCTGAGGGCAAG
AGTGTGTGAGAACTGCATGGAGATGGATGTGATGTCGGTGGCCACAATTGTCATAGTGGACATCTGCATC
ACTGGGGGCTTGCTGCTGCTGGTTTACTACTGGAGCAAGAATAGAAAGGCCAAGGCCAAGCCTGTGACAC
GAGGAGCGGGTGCTGGCGGCAGGCAAAGGGGACAAAACAAGGAGAGGCCACCACCTGTTCCCAACCCAGA
CTATGAGCCCATCCGGAAAGGCCAGCGGGACCTGTATTCTGGCCTGAATCAGAGACGCATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208276 representing NM_000733
Red=Cloning site Green=Tags(s)

MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDE
DDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICI
TGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000733
ORF Size 621 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000733.2, NP_000724.1
RefSeq Size 1377 bp
RefSeq ORF 624 bp
Locus ID 916
UniProt ID P07766
Cytogenetics 11q23.3
Domains IGc2, ITAM
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage, Primary immunodeficiency, T cell receptor signaling pathway
Summary The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CD3E (NM_000733) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208276 CD3E (Myc-DDK-tagged)-Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E) 10 ug
$300.00
RC208276L1 Lenti ORF clone of Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E), Myc-DDK-tagged 10 ug
$600.00
RC208276L2 Lenti ORF clone of Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E), mGFP tagged 10 ug
$600.00
RC208276L3 Lenti ORF clone of Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E), Myc-DDK-tagged 10 ug
$600.00
RC208276L4 Lenti ORF clone of Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E), mGFP tagged 10 ug
$600.00
SC128125 CD3E (untagged)-Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.