LC3B (MAP1LC3B) (NM_022818) Human Tagged ORF Clone

SKU
RG207356
MAP1LC3B (tGFP-tagged) - Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LC3B
Synonyms ATG8F; LC3B; MAP1A/1BLC3; MAP1LC3B-a
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG207356 representing NM_022818
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTCGGAGAAGACCTTCAAGCAGCGCCGCACCTTCGAACAAAGAGTAGAAGATGTCCGACTTATTC
GAGAGCAGCATCCAACCAAAATCCCGGTGATAATAGAACGATACAAGGGTGAGAAGCAGCTTCCTGTTCT
GGATAAAACAAAGTTCCTTGTACCTGACCATGTCAACATGAGTGAGCTCATCAAGATAATTAGAAGGCGC
TTACAGCTCAATGCTAATCAGGCCTTCTTCCTGTTGGTGAACGGACACAGCATGGTCAGCGTCTCCACAC
CAATCTCAGAGGTGTATGAGAGTGAGAAAGATGAAGATGGATTCCTGTACATGGTCTATGCCTCCCAGGA
GACGTTCGGGATGAAATTGTCAGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207356 representing NM_022818
Red=Cloning site Green=Tags(s)

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR
LQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_022818
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022818.5
RefSeq Size 2270 bp
RefSeq ORF 378 bp
Locus ID 81631
UniProt ID Q9GZQ8
Cytogenetics 16q24.2
Domains MAP1_LC3
Summary The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:LC3B (MAP1LC3B) (NM_022818) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207356 MAP1LC3B (Myc-DDK-tagged)-Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B) 10 ug
$289.00
RC207356L1 Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B), Myc-DDK-tagged 10 ug
$525.00
RC207356L2 Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B), mGFP tagged 10 ug
$525.00
RC207356L3 Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B), Myc-DDK-tagged 10 ug
$525.00
RC207356L4 Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B), mGFP tagged 10 ug
$525.00
SC108102 MAP1LC3B (untagged)-Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B) 10 ug
$225.00
SC322139 MAP1LC3B (untagged)-Human microtubule-associated protein 1 light chain 3 beta (MAP1LC3B) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.