MED19 (NM_153450) Human Tagged ORF Clone

SKU
RG206806
MED19 (tGFP-tagged) - Human mediator complex subunit 19 (MED19)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MED19
Synonyms DT2P1G7; LCMR1; MED19AS
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG206806 representing NM_153450
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAATTTCACGGCACTGTTTGGGGCTCAGGCTGACCCACCACCGCCCCCAACCGCACTCGGCTTCG
GACCAGGAAAGCCTCCACCCCCGCCACCGCCTCCTGCGGGCGGGGGACCCGGCACGGCCCCGCCTCCCAC
CGCGGCCACGGCTCCTCCTGGCGCGGACAAGTCAGGAGCTGGCTGTGGCCCTTTTTACCTCATGAGGGAA
CTGCCAGGTAGCACAGAGCTGACAGGCAGCACGAATCTGATCACACACTACAACTTGGAACAAGCCTATA
ATAAATTCTGTGGGAAGAAGGTGAAGGAGAAGCTAAGTAACTTCCTGCCTGACCTGCCAGGGATGATTGA
TCTGCCTGGTTCCCATGATAACAGCAGCCTCCGCTCTCTCATTGAGAAGCCCCCTATTCTCAGTAGCTCT
TTCAATCCTATCACAGGGACCATGCTGGCCGGCTTCCGCCTCCACACTGGCCCGTTGCCGGAGCAGTGTC
GTCTGATGCATATTCAGCCTCCCAAGAAGAAGAATAAGCACAAGCACAAACAGAGCCGTACCCAGGATCC
TGTCCCCCCAGGTAAACCCAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206806 representing NM_153450
Red=Cloning site Green=Tags(s)

MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRE
LPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSS
FNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_153450
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_153450.4
RefSeq Size 1605 bp
RefSeq ORF 585 bp
Locus ID 219541
UniProt ID A0JLT2
Cytogenetics 11q12.1
Protein Families Druggable Genome
Summary The protein encoded by this gene is a subunit of the Mediator complex, which binds to gene-specific regulatory factors and provides support for the basal RNA polymerase II transcription machinery. This gene has been implicated in the growth of several types of cancer, and inhibition of its expression inhibits the growth and spread of these cancers. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:MED19 (NM_153450) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206806 MED19 (Myc-DDK-tagged)-Human mediator complex subunit 19 (MED19) 10 ug
$300.00
RC206806L1 Lenti ORF clone of Human mediator complex subunit 19 (MED19), Myc-DDK-tagged 10 ug
$600.00
RC206806L2 Lenti ORF clone of Human mediator complex subunit 19 (MED19), mGFP tagged 10 ug
$600.00
RC206806L3 Lenti ORF clone of Human mediator complex subunit 19 (MED19), Myc-DDK-tagged 10 ug
$600.00
RC206806L4 Lenti ORF clone of Human mediator complex subunit 19 (MED19), mGFP tagged 10 ug
$600.00
SC123306 MED19 (untagged)-Human mediator complex subunit 19 (MED19) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.