SPINLW1 (EPPIN) (NM_020398) Human Tagged ORF Clone

SKU
RG206458
EPPIN (tGFP-tagged) - Human serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) (SPINLW1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SPINLW1
Synonyms CT71; CT72; dJ461P17.2; SPINLW1; WAP7; WFDC7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG206458 representing NM_020398
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGATCTTCTGGACTTTTGAGCCTCCTGGTGCTATTCGTCCTCTTAGCGAATGTCCAGGGACCTGGTC
TGACTGATTGGTTATTTCCCAGGAGATGTCCCAAAATCAGAGAAGAATGTGAATTCCAAGAAAGGGATGT
GTGTACAAAGGACAGACAATGCCAGGACAACAAGAAGTGTTGTGTCTTCAGCTGCGGAAAAAAATGTTTA
GATCTCAAACAAGATGTATGCGAAATGCCAAAAGAAACTGGCCCCTGCCTGGCTTATTTTCTTCATTGGT
GGTATGACAAGAAAGATAATACTTGCTCCATGTTTGTCTATGGTGGCTGCCAGGGAAACAATAACAACTT
CCAATCCAAAGCCAACTGCCTGAACACCTGCAAGAATAAACGCTTTCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206458 representing NM_020398
Red=Cloning site Green=Tags(s)

MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCL
DLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020398
ORF Size 399 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020398.4
RefSeq Size 1961 bp
RefSeq ORF 402 bp
Locus ID 57119
UniProt ID O95925
Cytogenetics 20q13.12
Protein Families Secreted Protein
Summary This gene encodes an epididymal protease inhibitor, which contains both kunitz-type and WAP-type four-disulfide core (WFDC) protease inhibitor consensus sequences. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene is a member of the WFDC gene family and belongs to the telomeric cluster. The protein can inhibit human sperm motility and exhibits antimicrobial activity against E. coli, and polymorphisms in this gene are associated with male infertility. Read-through transcription also exists between this gene and the downstream WFDC6 (WAP four-disulfide core domain 6) gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]
Write Your Own Review
You're reviewing:SPINLW1 (EPPIN) (NM_020398) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206458 EPPIN (Myc-DDK-tagged)-Human serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) (SPINLW1) 10 ug
$150.00
RC206458L3 Lenti ORF clone of Human serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) (SPINLW1), Myc-DDK-tagged 10 ug
$450.00
RC206458L4 Lenti ORF clone of Human serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) (SPINLW1), mGFP tagged 10 ug
$450.00
SC126420 EPPIN (untagged)-Human serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) (SPINLW1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.