PMP2 (NM_002677) Human Tagged ORF Clone

SKU
RG206053
PMP2 (tGFP-tagged) - Human peripheral myelin protein 2 (PMP2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PMP2
Synonyms CMT1G; FABP8; M-FABP; MP2; P2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG206053 representing NM_002677
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAACAAATTCCTGGGCACCTGGAAACTTGTCTCTAGTGAGAACTTTGACGATTACATGAAAGCTC
TGGGTGTGGGGTTAGCCACCAGAAAACTGGGAAATTTGGCCAAACCCACTGTGATCATCAGCAAGAAAGG
AGATATTATAACTATACGAACTGAAAGTACCTTTAAAAATACAGAAATCTCCTTCAAGCTAGGCCAGGAA
TTTGAAGAAACCACAGCTGACAATAGAAAGACCAAGAGCATCGTAACCCTGCAGAGAGGATCACTGAATC
AAGTGCAGAGATGGGATGGCAAAGAGACAACCATAAAGAGAAAGCTAGTGAATGGGAAAATGGTAGCGGA
ATGTAAAATGAAGGGCGTGGTGTGCACCAGAATCTATGAGAAGGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206053 representing NM_002677
Red=Cloning site Green=Tags(s)

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE
FEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002677
ORF Size 396 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002677.5
RefSeq Size 3579 bp
RefSeq ORF 399 bp
Locus ID 5375
UniProt ID P02689
Cytogenetics 8q21.13
Domains lipocalin
Summary The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy. [provided by RefSeq, Jan 2017]
Write Your Own Review
You're reviewing:PMP2 (NM_002677) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206053 PMP2 (Myc-DDK-tagged)-Human peripheral myelin protein 2 (PMP2) 10 ug
$150.00
RC206053L1 Lenti ORF clone of Human peripheral myelin protein 2 (PMP2), Myc-DDK-tagged 10 ug
$450.00
RC206053L2 Lenti ORF clone of Human peripheral myelin protein 2 (PMP2), mGFP tagged 10 ug
$450.00
RC206053L3 Lenti ORF clone of Human peripheral myelin protein 2 (PMP2), Myc-DDK-tagged 10 ug
$450.00
RC206053L4 Lenti ORF clone of Human peripheral myelin protein 2 (PMP2), mGFP tagged 10 ug
$450.00
SC118506 PMP2 (untagged)-Human peripheral myelin protein 2 (PMP2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.