PIGF (NM_002643) Human Tagged ORF Clone

SKU
RG205919
PIGF (tGFP-tagged) - Human phosphatidylinositol glycan anchor biosynthesis, class F (PIGF), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PIGF
Synonyms OORS
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205919 representing NM_002643
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGATAACGATATCAAGAGACTACTGTATACCCATCTTTTATGCATATTTTCAATTATCCTAAGTG
TCTTCATTCCATCACTCTTCTTGGAGAACTTCTCAATATTGGAAACACACTTGACATGGTTGTGCATCTG
TTCTGGTTTTGTAACTGCTGTCAATCTAGTACTATATTTAGTAGTGAAACCAAATACATCCTCTAAAAGA
AGTTCATTATCACACAAGGTAACTGGATTTTTGAAATGCTGTATCTACTTTCTTATGTCTTGTTTCTCCT
TTCATGTAATTTTTGTTCTGTATGGAGCACCACTGATAGAGTTGGCATTGGAAACATTTTTATTTGCAGT
TATTTTGTCTACTTTTACTACTGTGCCTTGCTTATGTTTGTTAGGACCAAACCTCAAAGCATGGCTAAGA
GTGTTCAGTAGAAATGGAGTTACATCCATATGGGAGAATAGTCTCCAGATCACTACAATTTCTAGCTTTG
TAGGAGCATGGCTTGGAGCACTTCCTATTCCACTGGATTGGGAAAGACCATGGCAGGTATGGCCCATCTC
CTGTACGCTTGGAGCGACCTTTGGCTACGTGGCTGGCCTTGTTATTTCACCACTCTGGATATACTGGAAT
AGAAAGCAACTTACATACAAGAACAAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205919 representing NM_002643
Red=Cloning site Green=Tags(s)

MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYLVVKPNTSSKR
SSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILSTFTTVPCLCLLGPNLKAWLR
VFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWN
RKQLTYKNN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002643
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002643.4
RefSeq Size 1009 bp
RefSeq ORF 660 bp
Locus ID 5281
UniProt ID Q07326
Cytogenetics 2p21
Protein Families Transmembrane
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways
Summary This gene encodes a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PIGF (NM_002643) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205919 PIGF (Myc-DDK-tagged)-Human phosphatidylinositol glycan anchor biosynthesis, class F (PIGF), transcript variant 1 10 ug
$300.00
RC205919L1 Lenti ORF clone of Human phosphatidylinositol glycan anchor biosynthesis, class F (PIGF), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205919L2 Lenti ORF clone of Human phosphatidylinositol glycan anchor biosynthesis, class F (PIGF), transcript variant 1, mGFP tagged 10 ug
$600.00
RC205919L3 Lenti ORF clone of Human phosphatidylinositol glycan anchor biosynthesis, class F (PIGF), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205919L4 Lenti ORF clone of Human phosphatidylinositol glycan anchor biosynthesis, class F (PIGF), transcript variant 1, mGFP tagged 10 ug
$600.00
SC118483 PIGF (untagged)-Human phosphatidylinositol glycan anchor biosynthesis, class F (PIGF), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.