MIF (NM_002415) Human Tagged ORF Clone

SKU
RG205106
MIF (tGFP-tagged) - Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MIF
Synonyms GIF; GLIF; MMIF
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205106 representing NM_002415
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGATGTTCATCGTAAACACCAACGTGCCCCGCGCCTCCGTGCCGGACGGGTTCCTCTCCGAGCTCA
CCCAGCAGCTGGCGCAGGCCACCGGCAAGCCCCCCCAGTACATCGCGGTGCACGTGGTCCCGGACCAGCT
CATGGCCTTCGGCGGCTCCAGCGAGCCGTGCGCGCTCTGCAGCCTGCACAGCATCGGCAAGATCGGCGGC
GCGCAGAACCGCTCCTACAGCAAGCTGCTGTGCGGCCTGCTGGCCGAGCGCCTGCGCATCAGCCCGGACA
GGGTCTACATCAACTATTACGACATGAACGCGGCCAATGTGGGCTGGAACAACTCCACCTTCGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205106 representing NM_002415
Red=Cloning site Green=Tags(s)

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG
AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002415
ORF Size 345 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002415.2
RefSeq Size 561 bp
RefSeq ORF 348 bp
Locus ID 4282
UniProt ID P14174
Cytogenetics 22q11.23
Domains MIF
Protein Families Druggable Genome
Protein Pathways Phenylalanine metabolism, Tyrosine metabolism
Summary This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MIF (NM_002415) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205106 MIF (Myc-DDK-tagged)-Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) 10 ug
$150.00
RC205106L1 Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), Myc-DDK-tagged 10 ug
$450.00
RC205106L2 Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mGFP tagged 10 ug
$450.00
RC205106L3 Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), Myc-DDK-tagged 10 ug
$450.00
RC205106L4 Lenti ORF clone of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), mGFP tagged 10 ug
$450.00
SC118641 MIF (untagged)-Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.