PPP1R1C (NM_001080545) Human Tagged ORF Clone

SKU
RG205047
PPP1R1C (tGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PPP1R1C
Synonyms IPP5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205047 representing NM_001080545
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCCAACAGTCCCAAAAAGATACAGTTTGCCGTGCCTGTATTCCAGAGTCAGATTGCACCTGAAG
CAGCAGAGCAGATCAGGAAAAGAAGACCTACACCAGCATCACTTGTGATTCTCAATGAGCATAACCCCCC
AGAAATAGATGACAAGAGGGGGCCCAACACACAAGGGGAATTACAGAATGCATCCCCTAAGCAAAGGAAG
CAGAGTGTGTACACACCACCCACCATAAAAGGGGTTAAGCATCTGAAAGGCCAGAATGAATCAGCATTCC
CTGAAGAAGAAGAAGGCACCAATGAAAGAGAGGAGCAGCGGGACCAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205047 representing NM_001080545
Red=Cloning site Green=Tags(s)

MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK
QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001080545
ORF Size 327 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001080545.2, NP_001074014.1
RefSeq Size 1014 bp
RefSeq ORF 330 bp
Locus ID 151242
UniProt ID Q8WVI7
Cytogenetics 2q31.3-q32.1
Protein Families Druggable Genome, Phosphatase
Summary Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM, Feb 2010]
Write Your Own Review
You're reviewing:PPP1R1C (NM_001080545) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205047 PPP1R1C (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C) 10 ug
$150.00
RC205047L3 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), Myc-DDK-tagged 10 ug
$450.00
RC205047L4 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), mGFP tagged 10 ug
$450.00
SC315666 PPP1R1C (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.