PKI alpha (PKIA) (NM_181839) Human Tagged ORF Clone

SKU
RG204652
PKIA (tGFP-tagged) - Human protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PKI alpha
Synonyms PRKACN1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204652 representing NM_181839
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGATGTGGAAACTACATATGCAGATTTTATTGCTTCAGGAAGAACAGGTAGAAGAAATGCAATAC
ATGATATCCTGGTTTCCTCTGCAAGTGGCAACAGCAATGAATTAGCCTTGAAATTAGCAGGTCTTGATAT
CAACAAGACAGAAGGTGAAGAAGATGCACAACGAAGTTCTACAGAACAAAGTGGGGAAGCCCAGGGAGAA
GCAGCAAAATCTGAAAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204652 representing NM_181839
Red=Cloning site Green=Tags(s)

MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGE
AAKSES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181839
ORF Size 228 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181839.3
RefSeq Size 2055 bp
RefSeq ORF 231 bp
Locus ID 5569
UniProt ID P61925
Cytogenetics 8q21.13
Protein Families Druggable Genome
Summary The protein encoded by this gene is a member of the cAMP-dependent protein kinase (PKA) inhibitor family. This protein was demonstrated to interact with and inhibit the activities of both C alpha and C beta catalytic subunits of the PKA. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PKI alpha (PKIA) (NM_181839) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204652 PKIA (Myc-DDK-tagged)-Human protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 2 10 ug
$150.00
RC204652L3 Lenti ORF clone of Human protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC204652L4 Lenti ORF clone of Human protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 2, mGFP tagged 10 ug
$450.00
SC109614 PKIA (untagged)-Human protein kinase (cAMP-dependent, catalytic) inhibitor alpha (PKIA), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.