CCN5 (NM_003881) Human Tagged ORF Clone

SKU
RG204636
WISP2 (tGFP-tagged) - Human WNT1 inducible signaling pathway protein 2 (WISP2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CCN5
Synonyms CT58; CTGF-L; WISP2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204636 representing NM_003881
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAGGCACACCGAAGACCCACCTCCTGGCCTTCTCCCTCCTCTGCCTCCTCTCAAAGGTGCGTACCC
AGCTGTGCCCGACACCATGTACCTGCCCCTGGCCACCTCCCCGATGCCCGCTGGGAGTACCCCTGGTGCT
GGATGGCTGTGGCTGCTGCCGGGTATGTGCACGGCGGCTGGGGGAGCCCTGCGACCAACTCCACGTCTGC
GACGCCAGCCAGGGCCTGGTCTGCCAGCCCGGGGCAGGACCCGGTGGCCGGGGGGCCCTGTGCCTCTTGG
CAGAGGACGACAGCAGCTGTGAGGTGAACGGCCGCCTGTATCGGGAAGGGGAGACCTTCCAGCCCCACTG
CAGCATCCGCTGCCGCTGCGAGGACGGCGGCTTCACCTGCGTGCCGCTGTGCAGCGAGGATGTGCGGCTG
CCCAGCTGGGACTGCCCCCACCCCAGGAGGGTCGAGGTCCTGGGCAAGTGCTGCCCTGAGTGGGTGTGCG
GCCAAGGAGGGGGACTGGGGACCCAGCCCCTTCCAGCCCAAGGACCCCAGTTTTCTGGCCTTGTCTCTTC
CCTGCCCCCTGGTGTCCCCTGCCCAGAATGGAGCACGGCCTGGGGACCCTGCTCGACCACCTGTGGGCTG
GGCATGGCCACCCGGGTGTCCAACCAGAACCGCTTCTGCCGACTGGAGACCCAGCGCCGCCTGTGCCTGT
CCAGGCCCTGCCCACCCTCCAGGGGTCGCAGTCCACAAAACAGTGCCTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204636 representing NM_003881
Red=Cloning site Green=Tags(s)

MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVC
DASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRL
PSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGL
GMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003881
ORF Size 750 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003881.3
RefSeq Size 1433 bp
RefSeq ORF 753 bp
Locus ID 8839
UniProt ID O76076
Cytogenetics 20q13.12
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Summary This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CCN5 (NM_003881) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204636 WISP2 (Myc-DDK-tagged)-Human WNT1 inducible signaling pathway protein 2 (WISP2) 10 ug
$450.00
RC204636L1 Lenti ORF clone of Human WNT1 inducible signaling pathway protein 2 (WISP2), Myc-DDK-tagged 10 ug
$750.00
RC204636L2 Lenti ORF clone of Human WNT1 inducible signaling pathway protein 2 (WISP2), mGFP tagged 10 ug
$750.00
RC204636L3 Lenti ORF clone of Human WNT1 inducible signaling pathway protein 2 (WISP2), Myc-DDK-tagged 10 ug
$750.00
RC204636L4 Lenti ORF clone of Human WNT1 inducible signaling pathway protein 2 (WISP2), mGFP tagged 10 ug
$750.00
SC122664 WISP2 (untagged)-Human WNT1 inducible signaling pathway protein 2 (WISP2) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.